(data stored in SCRATCH zone)

EMBL: CP000885.PE151

CP000885.PE151       Location/Qualifiers
FT   CDS             197521..199911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0153"
FT                   /product="MutS2 family protein"
FT                   /note="KEGG: cth:Cthe_1014 MutS2 family protein; TIGRFAM:
FT                   MutS2 family protein; PFAM: DNA mismatch repair protein
FT                   MutS domain protein; Smr protein/MutS2; SMART: MutS III
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40542"
FT                   /db_xref="GOA:A9KR74"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KR74"
FT                   /protein_id="ABX40542.1"
FT                   /translation="MNEKALRTLEYHKIIEKLSALAGSSLGREKCHQLLPLVKLEDIVQ
FT                   MQQETTDALTRLYAKGTLSFSGIPDIRDTLMRLEIGASLGAGELLKISSVLTATLRAKN
FT                   YGYNQKNNEETEEAAQDTLTERFHLLEPLSPINNEIRRCIISEEEIADDASPGLKSVRR
FT                   QIKITNDKIHESLGSILNSASTKGMLQDAIITMRNGRYCLPIKQEYKNTFQGMMHDQSS
FT                   TGSTAFIEPMAIVKLNNELAELAVREQEEIEKILAELSNLVATEKYNLKYNQTTLAELD
FT                   FIFARAGLSKNMKASQPHFNNRHYINIKKGRHPLIDPKKVVPIDIYFGDKFDLLVITGP
FT                   NTGGKTVSLKTVGLFTLMGQAGLHIPAFDGSELSIFEEVYADIGDEQSIEQSLSTFSSH
FT                   MTNTVSILEHANENSLVLFDELGAGTDPTEGAALAMAILSYLHQRKIRTMATTHYSELK
FT                   IFALSTDGVSNACCEFSVETLQPTYRLLIGIPGKSNAFAISSKLGLSNYIIEKAREFIG
FT                   TKDESFEDVISNLEASRIAMEKDKAEAEQYKKEVEELKRKLAEKNSKIDDAKDRILREA
FT                   NEKARTILQEAKDYADETIRKYNKWGAGGANNKEMENERAALREKLGDTDSSLVSKAKK
FT                   NRKQHKPSDFKVGDSVHVISLNLKGSVSTLPNAKGDLYVQMGILRSLVNISDLELIDEE
FT                   TIVAKALTKTQSGKIRMSKSMSISPELNIIGKRVDEALPLVDKYLDDAYLAHLPQVTII
FT                   HGRGTGALKEAVHAHLKRTNYVKGYRVGGFGEGDHGVTIVEFK"
     MNEKALRTLE YHKIIEKLSA LAGSSLGREK CHQLLPLVKL EDIVQMQQET TDALTRLYAK        60
     GTLSFSGIPD IRDTLMRLEI GASLGAGELL KISSVLTATL RAKNYGYNQK NNEETEEAAQ       120
     DTLTERFHLL EPLSPINNEI RRCIISEEEI ADDASPGLKS VRRQIKITND KIHESLGSIL       180
     NSASTKGMLQ DAIITMRNGR YCLPIKQEYK NTFQGMMHDQ SSTGSTAFIE PMAIVKLNNE       240
     LAELAVREQE EIEKILAELS NLVATEKYNL KYNQTTLAEL DFIFARAGLS KNMKASQPHF       300
     NNRHYINIKK GRHPLIDPKK VVPIDIYFGD KFDLLVITGP NTGGKTVSLK TVGLFTLMGQ       360
     AGLHIPAFDG SELSIFEEVY ADIGDEQSIE QSLSTFSSHM TNTVSILEHA NENSLVLFDE       420
     LGAGTDPTEG AALAMAILSY LHQRKIRTMA TTHYSELKIF ALSTDGVSNA CCEFSVETLQ       480
     PTYRLLIGIP GKSNAFAISS KLGLSNYIIE KAREFIGTKD ESFEDVISNL EASRIAMEKD       540
     KAEAEQYKKE VEELKRKLAE KNSKIDDAKD RILREANEKA RTILQEAKDY ADETIRKYNK       600
     WGAGGANNKE MENERAALRE KLGDTDSSLV SKAKKNRKQH KPSDFKVGDS VHVISLNLKG       660
     SVSTLPNAKG DLYVQMGILR SLVNISDLEL IDEETIVAKA LTKTQSGKIR MSKSMSISPE       720
     LNIIGKRVDE ALPLVDKYLD DAYLAHLPQV TIIHGRGTGA LKEAVHAHLK RTNYVKGYRV       780
     GGFGEGDHGV TIVEFK                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page