(data stored in SCRATCH zone)

EMBL: CP000885.PE160

CP000885.PE160       Location/Qualifiers
FT   CDS             208651..209175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40551"
FT                   /db_xref="GOA:A9KR83"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR83"
FT                   /protein_id="ABX40551.1"
FT                   /translation="MEGNFKGRKKNALNLKTPSAWIIVAATVFVLIFSIVFATNRANEG
FT                   IGDHDFYNFNVNGFTLGADIDKMDTSALTPTEPLNINNGYDYNFEEVRYSADENTGRLK
FT                   KMFVNVYDGAYIPVVTIHTGEAASYIPNNLTTIEQITTIFGQGKKGWQDREQGLRYMEY
FT                   RQKEGRLSATE"
     MEGNFKGRKK NALNLKTPSA WIIVAATVFV LIFSIVFATN RANEGIGDHD FYNFNVNGFT        60
     LGADIDKMDT SALTPTEPLN INNGYDYNFE EVRYSADENT GRLKKMFVNV YDGAYIPVVT       120
     IHTGEAASYI PNNLTTIEQI TTIFGQGKKG WQDREQGLRY MEYRQKEGRL SATE             174
//

If you have problems or comments...

PBIL Back to PBIL home page