(data stored in SCRATCH zone)

EMBL: CP000885.PE193

CP000885.PE193       Location/Qualifiers
FT   CDS             244835..245491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40584"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB6"
FT                   /protein_id="ABX40584.1"
FT                   /translation="MIATKRKTKREDNDLKKTTVALFTALLVLSLAGCSSAPSDEKIKT
FT                   ALEDGTITIEDAKEKGWIDDEWVEANFEPIKAKTKIYLFDSFQTTYLDGTPASSELIEG
FT                   KMCLVFFNTAKDGTMDKLKVFNDIREEMEDIGVPILGIITDEQLEDAKEKLNDIKFPIL
FT                   VYNEEMQKSLAEFNELIDSDVVSIFTKEGGFYSAWNSGCDSESLLDFARGLADEE"
     MIATKRKTKR EDNDLKKTTV ALFTALLVLS LAGCSSAPSD EKIKTALEDG TITIEDAKEK        60
     GWIDDEWVEA NFEPIKAKTK IYLFDSFQTT YLDGTPASSE LIEGKMCLVF FNTAKDGTMD       120
     KLKVFNDIRE EMEDIGVPIL GIITDEQLED AKEKLNDIKF PILVYNEEMQ KSLAEFNELI       180
     DSDVVSIFTK EGGFYSAWNS GCDSESLLDF ARGLADEE                               218
//

If you have problems or comments...

PBIL Back to PBIL home page