(data stored in SCRATCH zone)

EMBL: CP000885.PE197

CP000885.PE197       Location/Qualifiers
FT   CDS             249113..251323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0201"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: csc:Csac_2452
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40588"
FT                   /db_xref="GOA:A9KRC0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRC0"
FT                   /protein_id="ABX40588.1"
FT                   /translation="MMKKKGNQEEFKVKRLKRQSKKEENIEKLYKLNKELKQEKEIRQD
FT                   RYSKKREKKRIFGIRLRLALAFMVPIAFIIILGITSYNKASEAMLKSYEESSFQALKTT
FT                   TNYFELAMQTVELRLNQLKGYENLKNYYSGTYKSDPITEMTTYKNLQVYIETTTYSDNV
FT                   LANLYVFSKRGNNLSNYGSMDLSGAELVEAYLETEEGKRDEKENGAYSWSGKHQFVDEH
FT                   FVQDKSKITIPYAFSVSSAFFGNGFKQIGYMVADIRLDLFQKKLSELELSENSIFVAIS
FT                   KDGYEVHSNEAEGVLIADKSFYTDALASSELSGTSYVDFNGEKHLFLYSKATKSGITVC
FT                   GLVPYSYLISQAKAIRTSTVIYVLIAVVSALFIAVIMSTDMGSAINKIIVALKKASEGD
FT                   LTVSVNCQRKDEFGMLADSANNMISNVKGLIDKAQKVKDTISLSTDEVSDSAKQLLIAT
FT                   QNISTSIEEIRQGIVQQAEDSEKCLRQSDELTTRVNQVSYNVTTIEKLTEDSKAVVQQG
FT                   LVSIDILRDKSEETTKITNNIIGDIESLEAESESIGKIIGVINDIAEQTNLLSLNASIE
FT                   AARAGDAGRGFAVVADEIRKLAEQSVRASGEIATIISSIQGKTKLTVTTVQKSENIVKS
FT                   QGNALLNTIDLFQKIDASVGMIAKELTEITSGISGIKVAENTTLNAIESISAVSEETAA
FT                   SSEEVDSAANRQVESVSKLREATLHLEAETKELNEALNQFRI"
     MMKKKGNQEE FKVKRLKRQS KKEENIEKLY KLNKELKQEK EIRQDRYSKK REKKRIFGIR        60
     LRLALAFMVP IAFIIILGIT SYNKASEAML KSYEESSFQA LKTTTNYFEL AMQTVELRLN       120
     QLKGYENLKN YYSGTYKSDP ITEMTTYKNL QVYIETTTYS DNVLANLYVF SKRGNNLSNY       180
     GSMDLSGAEL VEAYLETEEG KRDEKENGAY SWSGKHQFVD EHFVQDKSKI TIPYAFSVSS       240
     AFFGNGFKQI GYMVADIRLD LFQKKLSELE LSENSIFVAI SKDGYEVHSN EAEGVLIADK       300
     SFYTDALASS ELSGTSYVDF NGEKHLFLYS KATKSGITVC GLVPYSYLIS QAKAIRTSTV       360
     IYVLIAVVSA LFIAVIMSTD MGSAINKIIV ALKKASEGDL TVSVNCQRKD EFGMLADSAN       420
     NMISNVKGLI DKAQKVKDTI SLSTDEVSDS AKQLLIATQN ISTSIEEIRQ GIVQQAEDSE       480
     KCLRQSDELT TRVNQVSYNV TTIEKLTEDS KAVVQQGLVS IDILRDKSEE TTKITNNIIG       540
     DIESLEAESE SIGKIIGVIN DIAEQTNLLS LNASIEAARA GDAGRGFAVV ADEIRKLAEQ       600
     SVRASGEIAT IISSIQGKTK LTVTTVQKSE NIVKSQGNAL LNTIDLFQKI DASVGMIAKE       660
     LTEITSGISG IKVAENTTLN AIESISAVSE ETAASSEEVD SAANRQVESV SKLREATLHL       720
     EAETKELNEA LNQFRI                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page