(data stored in SCRATCH zone)

EMBL: CP000885.PE236

CP000885.PE236       Location/Qualifiers
FT   CDS             297866..299836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0240"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: cdf:CD1616 putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40627"
FT                   /db_xref="GOA:A9KRZ6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ6"
FT                   /protein_id="ABX40627.1"
FT                   /translation="MILGGLSSRRGYYDEHNTRNKRKIRFFVIMGIGILSIVAFLLSLK
FT                   GMLHSEAEKKLLEYTGLSADYIKKSEAGKQFMEEKWGSGIFTIIPGAKNPTYFQGNAHS
FT                   YVVTIKGEAIGAFSESGKDALSIYGNNVIDSIETWEDTKVYQEIIDKKGLVILTKLANG
FT                   EKYYIAFTSPSWLENGYIISIVSYQEIIQEIQSVLKMAIVIVLFSLLAIILAFFYSILH
FT                   RNRIKKRRMDMGAVDKITGLPNPLLHKKKVKEKLTKGNESYAYVTFCIDNFELIYELSG
FT                   KQYCEKLLKQIASKIQIMLVDGELFTRYQNDEFGMLLEYHGELNLRKRLVEMFKYAGDL
FT                   PQEDNNFCSITFQCGVCEMKKNMDVKDLIQYARQVRNNEVNGYTPNIEFYNKKEEKGEQ
FT                   PKIEEITNALSHNEFLVYLQPILQLDTKRIAGAEALVRWNHKMDGILPPNVFLPMLEED
FT                   GSIVKLDMYVLEEVCEYLRDWMDKGKRAVPISVNLSGKHLERPEFITELVEIVDYYQIP
FT                   HELLEFEFSEVNLYGAMDMMKNAIQKLRELGFLIAIDQFGAGFSSLQLLKELPIHVLKI
FT                   DKKLIMNLEDSEFSNQEKTIVMHILSFAKARNLTVIAEGVETKEQQDLLIDQQCDMMQG
FT                   FYYQKPMPSEEFERLLDASGA"
     MILGGLSSRR GYYDEHNTRN KRKIRFFVIM GIGILSIVAF LLSLKGMLHS EAEKKLLEYT        60
     GLSADYIKKS EAGKQFMEEK WGSGIFTIIP GAKNPTYFQG NAHSYVVTIK GEAIGAFSES       120
     GKDALSIYGN NVIDSIETWE DTKVYQEIID KKGLVILTKL ANGEKYYIAF TSPSWLENGY       180
     IISIVSYQEI IQEIQSVLKM AIVIVLFSLL AIILAFFYSI LHRNRIKKRR MDMGAVDKIT       240
     GLPNPLLHKK KVKEKLTKGN ESYAYVTFCI DNFELIYELS GKQYCEKLLK QIASKIQIML       300
     VDGELFTRYQ NDEFGMLLEY HGELNLRKRL VEMFKYAGDL PQEDNNFCSI TFQCGVCEMK       360
     KNMDVKDLIQ YARQVRNNEV NGYTPNIEFY NKKEEKGEQP KIEEITNALS HNEFLVYLQP       420
     ILQLDTKRIA GAEALVRWNH KMDGILPPNV FLPMLEEDGS IVKLDMYVLE EVCEYLRDWM       480
     DKGKRAVPIS VNLSGKHLER PEFITELVEI VDYYQIPHEL LEFEFSEVNL YGAMDMMKNA       540
     IQKLRELGFL IAIDQFGAGF SSLQLLKELP IHVLKIDKKL IMNLEDSEFS NQEKTIVMHI       600
     LSFAKARNLT VIAEGVETKE QQDLLIDQQC DMMQGFYYQK PMPSEEFERL LDASGA           656
//

If you have problems or comments...

PBIL Back to PBIL home page