(data stored in SCRATCH zone)

EMBL: CP000885.PE240

CP000885.PE240       Location/Qualifiers
FT   CDS             302817..303632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0244"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG:
FT                   cth:Cthe_2621 protein of unknown function DUF1078-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40631"
FT                   /db_xref="GOA:A9KS00"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS00"
FT                   /protein_id="ABX40631.1"
FT                   /translation="MMRALWTGASGMISQQTSLDTISNNLSNINTAGYKKENAQFSSLL
FT                   YSKIQSKVTDSEGKVKPVIGQVGSGVRVTGIVSSFTQGTLQESNNDWDLAISGNGLFSV
FT                   RDSDGNTAYTRNGSFHIAIGAEGVTLASADGYPVLNTKGQPVVFNNNWDISKVTMDEYG
FT                   NLMYPDANNIAQRTGIQIGLTQFVNPAGLEKAGGSLFYETESSGAPLKEVENNNLKQSK
FT                   IHTGYLEASNVQTADEIVNLIVTQRAYEMNSKVITAADEMLQQANNLRR"
     MMRALWTGAS GMISQQTSLD TISNNLSNIN TAGYKKENAQ FSSLLYSKIQ SKVTDSEGKV        60
     KPVIGQVGSG VRVTGIVSSF TQGTLQESNN DWDLAISGNG LFSVRDSDGN TAYTRNGSFH       120
     IAIGAEGVTL ASADGYPVLN TKGQPVVFNN NWDISKVTMD EYGNLMYPDA NNIAQRTGIQ       180
     IGLTQFVNPA GLEKAGGSLF YETESSGAPL KEVENNNLKQ SKIHTGYLEA SNVQTADEIV       240
     NLIVTQRAYE MNSKVITAAD EMLQQANNLR R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page