(data stored in SCRATCH zone)

EMBL: CP000885.PE248

CP000885.PE248       Location/Qualifiers
FT   CDS             311051..312250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0252"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   amt:Amet_1623 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40639"
FT                   /db_xref="GOA:A9KS08"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS08"
FT                   /protein_id="ABX40639.1"
FT                   /translation="MNYVRKINIVFLFTITTIFISNFIPFRDFVSNEAFLLLISQAIIA
FT                   GPSIVFLIVESRRQKRFSDGLEINYYSMGYGTGEDKKSIREQLCFHKVSLSNVIWLILF
FT                   TICITPAINFVNAISRMFSVAAINDTMLNITQKNTYLFALFCVAFVPCVMEEIVYRGLF
FT                   YQGYRRVNPLGAAFLSAFLFGILHGNLNQFCYAFVMGIVFAFVIEATDSILSTMIIHFI
FT                   MNGWSITLVYAIPRLIEYLRNMANDAIARGDQGLADSITKLIGTDQVDFKQVLQESGNA
FT                   VLSDTNFIDILRTYGLTALLGGVLAFLIYRKIAKNTGRYEYIKSLFSKNKEYRLEGNHS
FT                   IPGDEYKGEGNHYISSDEYKGEGKVKARALFTLPLLIAIAICVFFLVINELTLQGIISM
FT                   "
     MNYVRKINIV FLFTITTIFI SNFIPFRDFV SNEAFLLLIS QAIIAGPSIV FLIVESRRQK        60
     RFSDGLEINY YSMGYGTGED KKSIREQLCF HKVSLSNVIW LILFTICITP AINFVNAISR       120
     MFSVAAINDT MLNITQKNTY LFALFCVAFV PCVMEEIVYR GLFYQGYRRV NPLGAAFLSA       180
     FLFGILHGNL NQFCYAFVMG IVFAFVIEAT DSILSTMIIH FIMNGWSITL VYAIPRLIEY       240
     LRNMANDAIA RGDQGLADSI TKLIGTDQVD FKQVLQESGN AVLSDTNFID ILRTYGLTAL       300
     LGGVLAFLIY RKIAKNTGRY EYIKSLFSKN KEYRLEGNHS IPGDEYKGEG NHYISSDEYK       360
     GEGKVKARAL FTLPLLIAIA ICVFFLVINE LTLQGIISM                              399
//

If you have problems or comments...

PBIL Back to PBIL home page