(data stored in SCRATCH zone)

EMBL: CP000885.PE255

CP000885.PE255       Location/Qualifiers
FT   CDS             320208..322196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0259"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: cth:Cthe_0309 excinuclease ABC, B subunit;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40646"
FT                   /db_xref="GOA:A9KS15"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS15"
FT                   /protein_id="ABX40646.1"
FT                   /translation="MDHFKLVSEFAPTGDQPEALEALVKGFEEGNQFETLLGVTGSGKT
FT                   FTMANVIQRLNRPTLIIAHNKTLAAQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVPST
FT                   DTYIEKDSAINDEIDKLRHSATAALTERRDVIIVASVSCIYGLGSPVDYQNMTLSLRPG
FT                   MIRDRDDVLRRLVEIQYTRNDMDFKRGTFRVRGDVVEIFPITGTDLAYRVEFFGDEVER
FT                   ITEIDVLTGEIKCTLEHMVIFPASHYVVSKDNLERAIVNIEEELEDRIRYFKSEDKLLE
FT                   AQRISERTHFDIEMLRETGFCSGVENYSMHLAGLTPESTPHTLIDYFPDDFLIMVDESH
FT                   ITIPQVRGMYAGDQSRKTTLVDFGFRLPSAKSNRPLNFTEFESKINQMLFVSATPNVYE
FT                   KDHELLRAEQIIRPTGLLDPVVEVRPVHGQIDDLVSEVNKETAKKNKVMITTLTKRMAE
FT                   DLTDYMRELGIRIKYLHSDIDTLERSEIIRDMRMDVFDVLVGINLLREGLDIPEISLVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNAEGRVIMYADRITDSMDKALRETERRRKIQDEY
FT                   NEKHGITPQTIKKKVRELISISKKVSKEMYDMNIKDYESMSRKELEAVAKKLTKEMHTA
FT                   AAELNFELAAELRDKLLELKKQINELE"
     MDHFKLVSEF APTGDQPEAL EALVKGFEEG NQFETLLGVT GSGKTFTMAN VIQRLNRPTL        60
     IIAHNKTLAA QLYGEFKEFF PENAVEYFVS YYDYYQPEAY VPSTDTYIEK DSAINDEIDK       120
     LRHSATAALT ERRDVIIVAS VSCIYGLGSP VDYQNMTLSL RPGMIRDRDD VLRRLVEIQY       180
     TRNDMDFKRG TFRVRGDVVE IFPITGTDLA YRVEFFGDEV ERITEIDVLT GEIKCTLEHM       240
     VIFPASHYVV SKDNLERAIV NIEEELEDRI RYFKSEDKLL EAQRISERTH FDIEMLRETG       300
     FCSGVENYSM HLAGLTPEST PHTLIDYFPD DFLIMVDESH ITIPQVRGMY AGDQSRKTTL       360
     VDFGFRLPSA KSNRPLNFTE FESKINQMLF VSATPNVYEK DHELLRAEQI IRPTGLLDPV       420
     VEVRPVHGQI DDLVSEVNKE TAKKNKVMIT TLTKRMAEDL TDYMRELGIR IKYLHSDIDT       480
     LERSEIIRDM RMDVFDVLVG INLLREGLDI PEISLVAILD ADKEGFLRSE TSLIQTIGRA       540
     ARNAEGRVIM YADRITDSMD KALRETERRR KIQDEYNEKH GITPQTIKKK VRELISISKK       600
     VSKEMYDMNI KDYESMSRKE LEAVAKKLTK EMHTAAAELN FELAAELRDK LLELKKQINE       660
     LE                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page