(data stored in SCRATCH zone)

EMBL: CP000885.PE26

CP000885.PE26        Location/Qualifiers
FT   CDS             complement(42711..42926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40417"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA8"
FT                   /protein_id="ABX40417.1"
FT                   /translation="MKLFKKNQDEFNKELLKEIANTQKELESAYSNFENVVDPDLIDSC
FT                   IYQVNAIQHRYKFLLKQVKNSAPYSV"
     MKLFKKNQDE FNKELLKEIA NTQKELESAY SNFENVVDPD LIDSCIYQVN AIQHRYKFLL        60
     KQVKNSAPYS V                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page