(data stored in SCRATCH zone)

EMBL: CP000885.PE260

CP000885.PE260       Location/Qualifiers
FT   CDS             329775..331298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0264"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; KEGG: cth:Cthe_0375 GMP
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40651"
FT                   /db_xref="GOA:A9KS20"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS20"
FT                   /protein_id="ABX40651.1"
FT                   /translation="MVIVLDFGGQYNQLIARRVRECNVYCEVMPYNISLEKIKELNPKG
FT                   IIFTGGPASVYAEGAPHCDKGIFELGIPVLGICYGAQLMTHLLGGSVTSAEVREYGKTE
FT                   IKVNTTSKLFKDVAENTICWMSHTDHIKTPAEGFVVTSSSDSCPVAAVEMVDKKLYSVQ
FT                   FHPEVVHTQEGTKMLRNFLYEVCECNGDWKMASFTEESIQALRDKIGDKKVLCALSGGV
FT                   DSSVAAVMISKAVGKQLTCIFVDHGLLRKNEGDEVEQIFTTQFDVNFVRVNAQQRFYDR
FT                   LAGVTDPETKRKIIGEEFIRVFEEEAKKIGTVDFLAQGTIYPDVIESGLGKSAVIKSHH
FT                   NVGGLPEHVDFKEIVEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIRIIGEVT
FT                   PERIKLVQEADAIYREEIANAGLDRSIGQYFAALTNMQSVGCMGDERTYDYAIALRAVT
FT                   TTDFMTAEFAELPWELLGKVSSRIVNEVKGVNRVLYDCTGKPPATIEFE"
     MVIVLDFGGQ YNQLIARRVR ECNVYCEVMP YNISLEKIKE LNPKGIIFTG GPASVYAEGA        60
     PHCDKGIFEL GIPVLGICYG AQLMTHLLGG SVTSAEVREY GKTEIKVNTT SKLFKDVAEN       120
     TICWMSHTDH IKTPAEGFVV TSSSDSCPVA AVEMVDKKLY SVQFHPEVVH TQEGTKMLRN       180
     FLYEVCECNG DWKMASFTEE SIQALRDKIG DKKVLCALSG GVDSSVAAVM ISKAVGKQLT       240
     CIFVDHGLLR KNEGDEVEQI FTTQFDVNFV RVNAQQRFYD RLAGVTDPET KRKIIGEEFI       300
     RVFEEEAKKI GTVDFLAQGT IYPDVIESGL GKSAVIKSHH NVGGLPEHVD FKEIVEPLRL       360
     LFKDEVRKAG LELGIPEKLV FRQPFPGPGL GIRIIGEVTP ERIKLVQEAD AIYREEIANA       420
     GLDRSIGQYF AALTNMQSVG CMGDERTYDY AIALRAVTTT DFMTAEFAEL PWELLGKVSS       480
     RIVNEVKGVN RVLYDCTGKP PATIEFE                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page