(data stored in SCRATCH zone)

EMBL: CP000885.PE267

CP000885.PE267       Location/Qualifiers
FT   CDS             339345..339923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40658"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS27"
FT                   /protein_id="ABX40658.1"
FT                   /translation="MESENINSEWNKQIVNHRQYNKICSKHGSVLVKSPNSKCRRCIEE
FT                   MKNNYNDLNHNGIVKIIEKLKNKYDVIMVPTYIPEGSVRWNGRRKNFENPLSEIYNLYY
FT                   FVYIKFCVNKEGVIRALVAGKTGSKKVNYSGSDINFFESVNHGEARKLLKEKNMKWYKD
FT                   EILVIKADDEDSAYRIENEVQECFNLFGS"
     MESENINSEW NKQIVNHRQY NKICSKHGSV LVKSPNSKCR RCIEEMKNNY NDLNHNGIVK        60
     IIEKLKNKYD VIMVPTYIPE GSVRWNGRRK NFENPLSEIY NLYYFVYIKF CVNKEGVIRA       120
     LVAGKTGSKK VNYSGSDINF FESVNHGEAR KLLKEKNMKW YKDEILVIKA DDEDSAYRIE       180
     NEVQECFNLF GS                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page