(data stored in SCRATCH zone)

EMBL: CP000885.PE271

CP000885.PE271       Location/Qualifiers
FT   CDS             343239..344069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0275"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mla:Mlab_0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40662"
FT                   /db_xref="GOA:A9KS31"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS31"
FT                   /protein_id="ABX40662.1"
FT                   /translation="MDNEKMALFIADQRKIKKLTQKELAAKLGVTDKAVSKWERGLSCP
FT                   DISLLSTLSDILGVTTGELLNGERAVMLENTNVDSIVESTIQYADTVTKRKSKDIRNAF
FT                   AVTITSLFLLGIMVCLICNFAISGKLTWAWFPISSIIYMWLLVIPMVICKKRGVCISLV
FT                   CTSLFTIPYLYVLERVIGIDRLIMPIAMPVSIVSLLYLWIVYVLLVKFTWGRYLSASIA
FT                   LIFGIPLSFGINFILSKQIGEPIMDIWDILVYSLLILLAVIIYVTGYIRNNARK"
     MDNEKMALFI ADQRKIKKLT QKELAAKLGV TDKAVSKWER GLSCPDISLL STLSDILGVT        60
     TGELLNGERA VMLENTNVDS IVESTIQYAD TVTKRKSKDI RNAFAVTITS LFLLGIMVCL       120
     ICNFAISGKL TWAWFPISSI IYMWLLVIPM VICKKRGVCI SLVCTSLFTI PYLYVLERVI       180
     GIDRLIMPIA MPVSIVSLLY LWIVYVLLVK FTWGRYLSAS IALIFGIPLS FGINFILSKQ       240
     IGEPIMDIWD ILVYSLLILL AVIIYVTGYI RNNARK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page