(data stored in SCRATCH zone)

EMBL: CP000885.PE272

CP000885.PE272       Location/Qualifiers
FT   CDS             complement(344532..345398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0276"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: dsy:DSY1016
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40663"
FT                   /db_xref="GOA:A9KS32"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS32"
FT                   /protein_id="ABX40663.1"
FT                   /translation="MKTVKQVAELTGISVRTLQYYDEIDLFKPSEVTDAGYRLYDDVSL
FT                   ETLQQILFFKELDFPLKDIKQIMENPQYDKFTAYKKQKELIRAKRDRLDRLLNLLEKLE
FT                   RGEQCMSFKEFDMSDYFHALQQFKSDHTDEVVKHWGSIEAFDSMLENFKDKESEIAKLA
FT                   IQQYGSIEKYTEAMKANLKNFPETMEKLQSLGKDKDDYLTRSKEINEKLTKDLTLDVAS
FT                   NEVQELVKEMVLLSNEVNKGFDMGENFWDMVIEGYLHSEQLIKANDSLYGEGASAFIGR
FT                   ALEEYFK"
     MKTVKQVAEL TGISVRTLQY YDEIDLFKPS EVTDAGYRLY DDVSLETLQQ ILFFKELDFP        60
     LKDIKQIMEN PQYDKFTAYK KQKELIRAKR DRLDRLLNLL EKLERGEQCM SFKEFDMSDY       120
     FHALQQFKSD HTDEVVKHWG SIEAFDSMLE NFKDKESEIA KLAIQQYGSI EKYTEAMKAN       180
     LKNFPETMEK LQSLGKDKDD YLTRSKEINE KLTKDLTLDV ASNEVQELVK EMVLLSNEVN       240
     KGFDMGENFW DMVIEGYLHS EQLIKANDSL YGEGASAFIG RALEEYFK                    288
//

If you have problems or comments...

PBIL Back to PBIL home page