(data stored in SCRATCH zone)

EMBL: CP000885.PE278

CP000885.PE278       Location/Qualifiers
FT   CDS             350094..351305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40669"
FT                   /db_xref="GOA:A9KS38"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS38"
FT                   /protein_id="ABX40669.1"
FT                   /translation="MYSIIEKPLWTKEYVNELFLSRNTKDKKQLRNSLLYFFTVTILGI
FT                   GVGLITNSILLSEENSKFWLIAILFTWLDGILLIVIHEAGHFVGGIITSYRFQSFRVFS
FT                   YCIVKEDNKYKIEKRKIPGTSGQCLMKPPKNWTLDSPFFLYHAGGGIATFLVSMLSLLL
FT                   FKLTSSPLAQIIFFILFGYGLILTIINLVPLQLPSSNNDGANILAIRRDKTAKETFFKQ
FT                   LECNAWLSDGRKLEDISEDYLKLSENAVWSEPLNYYLEWILYSKFLKEREFDKAEELLM
FT                   KMEEAYHDMLPSKKIRIDSERLYLLIIRQVDTDCINTFYKNVADKLRIQKLCTPILRTL
FT                   IAYEKYSNNNNNNNNKCALEQYQRMFYRAMKSAACKQEAEVDYILTYQVEEACDTEKGS
FT                   SDLI"
     MYSIIEKPLW TKEYVNELFL SRNTKDKKQL RNSLLYFFTV TILGIGVGLI TNSILLSEEN        60
     SKFWLIAILF TWLDGILLIV IHEAGHFVGG IITSYRFQSF RVFSYCIVKE DNKYKIEKRK       120
     IPGTSGQCLM KPPKNWTLDS PFFLYHAGGG IATFLVSMLS LLLFKLTSSP LAQIIFFILF       180
     GYGLILTIIN LVPLQLPSSN NDGANILAIR RDKTAKETFF KQLECNAWLS DGRKLEDISE       240
     DYLKLSENAV WSEPLNYYLE WILYSKFLKE REFDKAEELL MKMEEAYHDM LPSKKIRIDS       300
     ERLYLLIIRQ VDTDCINTFY KNVADKLRIQ KLCTPILRTL IAYEKYSNNN NNNNNKCALE       360
     QYQRMFYRAM KSAACKQEAE VDYILTYQVE EACDTEKGSS DLI                         403
//

If you have problems or comments...

PBIL Back to PBIL home page