(data stored in SCRATCH zone)

EMBL: CP000885.PE3

CP000885.PE3         Location/Qualifiers
FT   CDS             3099..3314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   art:Arth_1328 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40394"
FT                   /db_xref="GOA:A9KPP3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP3"
FT                   /protein_id="ABX40394.1"
FT                   /translation="MEKIILREEFIKLGQALKAAGLVDSGVEAKDVITEGLVKVNGVVE
FT                   YQRGKKIHGGDSIEFNNEIVQIVDHE"
     MEKIILREEF IKLGQALKAA GLVDSGVEAK DVITEGLVKV NGVVEYQRGK KIHGGDSIEF        60
     NNEIVQIVDH E                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page