(data stored in SCRATCH zone)

EMBL: CP000885.PE301

CP000885.PE301       Location/Qualifiers
FT   CDS             381918..383780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0305"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: cth:Cthe_2244
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40692"
FT                   /db_xref="GOA:A9KSP8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP8"
FT                   /protein_id="ABX40692.1"
FT                   /translation="MSLMSSLYVGVSGLQVSQNGLNTTGHNLANVETEGYVRQQTVLQT
FT                   SQYRTIGQSYISPMQLGLGAETAAVRQVRDIFLDKSYRQELGRRGFYDSQYETVSEIEN
FT                   LMGELEGVAFQDSIADFWKNLQELAKEPDSLVKRASLVETSVGFVERSENLFKQLRDYQ
FT                   LNLNLKITNTISRINEIGDQISSLNDRICAYESNRVEHANDLRDTRNKLLDELSQMITI
FT                   TYRENADGRVTVNAEGVPFVTEDLTHHMGSMTVTQIRQRQLDEDEFNSTGMMENSDMLI
FT                   PIWPTYGNVEVFNRDLIPNPVDNSDIGSLKGLILARGTKVAKATDIPIAPNKDNYLDEF
FT                   GDLKEDEYNLALKDYKEAVKTYNKTIEPSIVMSTQAQYDQLIHGIVTKINDILCPNKEV
FT                   VIAAGTTIQLSNGDTYTYDKDTVIKIFDDENAPIGINGEGGTELFSRKSMPRYMDYQEI
FT                   TLANGDTILAKIYNEEDEANNYSLYTVGELVVNQEMIEDKSKIPLSQSSNTGDYDIKTT
FT                   ERLLKAWQEPFATLSPNTLTKSNINDYYNALIGGIATTGERYHTIVKSQEGMVTSIDNQ
FT                   RQSVLGVASDDELTSLIKFQHAYNAAARYINVIDQMLEHIVTRI"
     MSLMSSLYVG VSGLQVSQNG LNTTGHNLAN VETEGYVRQQ TVLQTSQYRT IGQSYISPMQ        60
     LGLGAETAAV RQVRDIFLDK SYRQELGRRG FYDSQYETVS EIENLMGELE GVAFQDSIAD       120
     FWKNLQELAK EPDSLVKRAS LVETSVGFVE RSENLFKQLR DYQLNLNLKI TNTISRINEI       180
     GDQISSLNDR ICAYESNRVE HANDLRDTRN KLLDELSQMI TITYRENADG RVTVNAEGVP       240
     FVTEDLTHHM GSMTVTQIRQ RQLDEDEFNS TGMMENSDML IPIWPTYGNV EVFNRDLIPN       300
     PVDNSDIGSL KGLILARGTK VAKATDIPIA PNKDNYLDEF GDLKEDEYNL ALKDYKEAVK       360
     TYNKTIEPSI VMSTQAQYDQ LIHGIVTKIN DILCPNKEVV IAAGTTIQLS NGDTYTYDKD       420
     TVIKIFDDEN APIGINGEGG TELFSRKSMP RYMDYQEITL ANGDTILAKI YNEEDEANNY       480
     SLYTVGELVV NQEMIEDKSK IPLSQSSNTG DYDIKTTERL LKAWQEPFAT LSPNTLTKSN       540
     INDYYNALIG GIATTGERYH TIVKSQEGMV TSIDNQRQSV LGVASDDELT SLIKFQHAYN       600
     AAARYINVID QMLEHIVTRI                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page