(data stored in SCRATCH zone)

EMBL: CP000885.PE305

CP000885.PE305       Location/Qualifiers
FT   CDS             387891..388109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0309"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="PFAM: carbon storage regulator; KEGG: lbl:LBL_0100
FT                   carbon storage regulator protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40696"
FT                   /db_xref="GOA:A9KSQ2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSQ2"
FT                   /protein_id="ABX40696.1"
FT                   /translation="MLALSRKLNESIMLGNDIEITILEIKGDQVKIGIKAPKSVPIYRK
FT                   EIYLQIQESNKEAIDGGVSLEAISKLF"
     MLALSRKLNE SIMLGNDIEI TILEIKGDQV KIGIKAPKSV PIYRKEIYLQ IQESNKEAID        60
     GGVSLEAISK LF                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page