(data stored in SCRATCH zone)

EMBL: CP000885.PE311

CP000885.PE311       Location/Qualifiers
FT   CDS             392760..393596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0315"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: cbh:CLC_2604
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40702"
FT                   /db_xref="GOA:A9KSQ8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ8"
FT                   /protein_id="ABX40702.1"
FT                   /translation="MIIQHNMTSANTSRQLGITTGNLAKSSEKLSSGYRINRAGDDAAG
FT                   LSISEKMRGQIRGLEQGSTNAQDGISLIQTAEGALNEVHSIVQRMRELTVQASNDTYVD
FT                   EDRTSISNEMKQLSKEIDRIGTDTEFNTLKLFAADNTKYNFQVGANSDQLIEVTMKQIS
FT                   AAKLGIDDAKIADIVGTAGKTGTDITKLIDTVNSGLTIVSAFRSDLGAVQNRLEHTIAN
FT                   ADNTAENLQASESRIRDTNMAKEMVKYSKDNILQQAAQSMLAQANQSTQGVLSLLR"
     MIIQHNMTSA NTSRQLGITT GNLAKSSEKL SSGYRINRAG DDAAGLSISE KMRGQIRGLE        60
     QGSTNAQDGI SLIQTAEGAL NEVHSIVQRM RELTVQASND TYVDEDRTSI SNEMKQLSKE       120
     IDRIGTDTEF NTLKLFAADN TKYNFQVGAN SDQLIEVTMK QISAAKLGID DAKIADIVGT       180
     AGKTGTDITK LIDTVNSGLT IVSAFRSDLG AVQNRLEHTI ANADNTAENL QASESRIRDT       240
     NMAKEMVKYS KDNILQQAAQ SMLAQANQST QGVLSLLR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page