(data stored in SCRATCH zone)

EMBL: CP000885.PE342

CP000885.PE342       Location/Qualifiers
FT   CDS             439293..439724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0346"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cth:Cthe_1776 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40733"
FT                   /db_xref="GOA:A9KST9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST9"
FT                   /protein_id="ABX40733.1"
FT                   /translation="MKYESYTEGDTYRLGKQMGENAQKGQVYCLSGELGVGKTVFTKGF
FT                   AAGLGIAEPISSPTFTIVQEYEQGELPLYHFDVYRIEDIEEMEEIGYEDYFYGDGVCLV
FT                   EWAVRIKELLPEDYIQITIEKDLDKGFDYRVISVEENQI"
     MKYESYTEGD TYRLGKQMGE NAQKGQVYCL SGELGVGKTV FTKGFAAGLG IAEPISSPTF        60
     TIVQEYEQGE LPLYHFDVYR IEDIEEMEEI GYEDYFYGDG VCLVEWAVRI KELLPEDYIQ       120
     ITIEKDLDKG FDYRVISVEE NQI                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page