(data stored in SCRATCH zone)

EMBL: CP000885.PE352

CP000885.PE352       Location/Qualifiers
FT   CDS             complement(454276..454560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40743"
FT                   /db_xref="GOA:A9KSU9"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU9"
FT                   /protein_id="ABX40743.1"
FT                   /translation="MDILIIMGIGIFIGSRFFPEKHKKKNEKMQIVCTILIIFSMGVML
FT                   GKREHFLQEISTLGLTSFLYFFIPTVFSTLIVYLLTRLFMKKKLKEKED"
     MDILIIMGIG IFIGSRFFPE KHKKKNEKMQ IVCTILIIFS MGVMLGKREH FLQEISTLGL        60
     TSFLYFFIPT VFSTLIVYLL TRLFMKKKLK EKED                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page