(data stored in SCRATCH zone)

EMBL: CP000885.PE369

CP000885.PE369       Location/Qualifiers
FT   CDS             complement(474739..476121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0373"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: dsy:DSY4985 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40760"
FT                   /db_xref="GOA:A9KSW6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW6"
FT                   /protein_id="ABX40760.1"
FT                   /translation="MNNLLKSIQTINHYLWGGPMLFLLFGTHLYFTFRLRFIQKELKKG
FT                   IRNSVSTKTDAHGNSSSFKTLTTTLAATLGTGNIVGISTAVALGGPGAVLWCWLTGIFG
FT                   MATTYAECYLGMWYRKQKPDGTYSGGPMYALEYGLHSKWLAVIFCIATLFVAFSMGGFT
FT                   QARSITDATKSLGISPILTGIIAAFLIGLVIVGGVNSIQNVCMKLVPAMAIFYVAGCVI
FT                   ILFVNLPYVLPTLSTIVKTAFSTKAVTGGVLGGSIGIAARYGISRGLFTNEAGLGSAAI
FT                   AAGGSAITDESSISESVPSSSKAKSTQNHSDSLDLRYKNQALVSMSATFWDTVVMCALT
FT                   GLIIVSTILKNPDSIKGLSMGELTTAAFAQIPFGVFMLRISLVAFAVATLIGWSYFGEK
FT                   AVEYLFPKKGIDIYRLVYILMIFFGSIMSLELVWESSDLINAFMTIPNLIALWLLRKKI
FT                   KC"
     MNNLLKSIQT INHYLWGGPM LFLLFGTHLY FTFRLRFIQK ELKKGIRNSV STKTDAHGNS        60
     SSFKTLTTTL AATLGTGNIV GISTAVALGG PGAVLWCWLT GIFGMATTYA ECYLGMWYRK       120
     QKPDGTYSGG PMYALEYGLH SKWLAVIFCI ATLFVAFSMG GFTQARSITD ATKSLGISPI       180
     LTGIIAAFLI GLVIVGGVNS IQNVCMKLVP AMAIFYVAGC VIILFVNLPY VLPTLSTIVK       240
     TAFSTKAVTG GVLGGSIGIA ARYGISRGLF TNEAGLGSAA IAAGGSAITD ESSISESVPS       300
     SSKAKSTQNH SDSLDLRYKN QALVSMSATF WDTVVMCALT GLIIVSTILK NPDSIKGLSM       360
     GELTTAAFAQ IPFGVFMLRI SLVAFAVATL IGWSYFGEKA VEYLFPKKGI DIYRLVYILM       420
     IFFGSIMSLE LVWESSDLIN AFMTIPNLIA LWLLRKKIKC                             460
//

If you have problems or comments...

PBIL Back to PBIL home page