(data stored in SCRATCH zone)

EMBL: CP000885.PE390

CP000885.PE390       Location/Qualifiers
FT   CDS             505226..506137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0394"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3118 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40781"
FT                   /db_xref="GOA:A9KHB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB4"
FT                   /protein_id="ABX40781.1"
FT                   /translation="MKRKNKMKQSRGDKIFVIVNYTLLTVILLLCLYPLWFVMISSVSN
FT                   PDLVNSGKVWLLPKEISFTGYKNLFHDKSIIRGYINTLIYTGGGTMLNLAVTLPAAYAL
FT                   SRKDFVGRKFFTLMFLFTMFFSGGLIPTFMTVKNLGLYNSPWVMVILGATSMTNIIISR
FT                   TFFMTNIPNELHEAAQIDGCGNVRLFLQVVLPISTAICAVMALFFAVNHWNGYFTALIY
FT                   IRDDRYKPLQIIMREVLMRSKFNAEMLQQGGDSAGLLQEELRAAEQIKYALIVIASLPV
FT                   MAIYPFIQKYFVKGVTVGAVKG"
     MKRKNKMKQS RGDKIFVIVN YTLLTVILLL CLYPLWFVMI SSVSNPDLVN SGKVWLLPKE        60
     ISFTGYKNLF HDKSIIRGYI NTLIYTGGGT MLNLAVTLPA AYALSRKDFV GRKFFTLMFL       120
     FTMFFSGGLI PTFMTVKNLG LYNSPWVMVI LGATSMTNII ISRTFFMTNI PNELHEAAQI       180
     DGCGNVRLFL QVVLPISTAI CAVMALFFAV NHWNGYFTAL IYIRDDRYKP LQIIMREVLM       240
     RSKFNAEMLQ QGGDSAGLLQ EELRAAEQIK YALIVIASLP VMAIYPFIQK YFVKGVTVGA       300
     VKG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page