(data stored in SCRATCH zone)

EMBL: CP000885.PE394

CP000885.PE394       Location/Qualifiers
FT   CDS             510532..511797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0398"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bca:BCE_1902 oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40785"
FT                   /db_xref="GOA:A9KHB8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB8"
FT                   /protein_id="ABX40785.1"
FT                   /translation="MEKIKLALVGAGERGQNSYAPYAKLHGYEIEFVAVAEPDFGRREQ
FT                   FCKDYGVSKEHAYESAEDFLSQGKIADAVLICTQDKDHFDYACTAIHLGYDILLEKPIS
FT                   PDPLECIQLEELAVKHGTTIVVCHVMRYTKFYRKIKEIMESGVIGDVVSITHTENVAYW
FT                   HYAHSYVRGNWHRREDSSPMILAKCCHDMDILAWLLDSRCKSISSYGDLTYFKEENAPV
FT                   GSPKRCMDGCPHSSTCPYYAPKIYLTEDTKWPTSCLGTDTSYEARKKALQEGPYGVCVF
FT                   HNDNDVVDHQVASILFENGVTVAFTMCAFSNACDRTIKFMGTKGEIRASMEKNTIEVTE
FT                   FGQGIMTGTTNVYTLIPGDTGHSGGDEGIMEEFVSILKGVRKNTNTISQSVHSHIMAFA
FT                   AEESRLQGKTIEIVDYEKKFRS"
     MEKIKLALVG AGERGQNSYA PYAKLHGYEI EFVAVAEPDF GRREQFCKDY GVSKEHAYES        60
     AEDFLSQGKI ADAVLICTQD KDHFDYACTA IHLGYDILLE KPISPDPLEC IQLEELAVKH       120
     GTTIVVCHVM RYTKFYRKIK EIMESGVIGD VVSITHTENV AYWHYAHSYV RGNWHRREDS       180
     SPMILAKCCH DMDILAWLLD SRCKSISSYG DLTYFKEENA PVGSPKRCMD GCPHSSTCPY       240
     YAPKIYLTED TKWPTSCLGT DTSYEARKKA LQEGPYGVCV FHNDNDVVDH QVASILFENG       300
     VTVAFTMCAF SNACDRTIKF MGTKGEIRAS MEKNTIEVTE FGQGIMTGTT NVYTLIPGDT       360
     GHSGGDEGIM EEFVSILKGV RKNTNTISQS VHSHIMAFAA EESRLQGKTI EIVDYEKKFR       420
     S                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page