(data stored in SCRATCH zone)

EMBL: CP000885.PE421

CP000885.PE421       Location/Qualifiers
FT   CDS             539001..539975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0425"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: tte:TTE0344 predicted
FT                   TIM-barrel enzyme, possibly dehydrogenase, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40812"
FT                   /db_xref="GOA:A9KHE5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE5"
FT                   /protein_id="ABX40812.1"
FT                   /translation="MSFTIGNVNINGNLVLGPMAGVTDLPFRLLCKEQGADLIYTEMVS
FT                   AKGIYYNNKNTEVLLEVEEKERPVALQLFGEDPYIMSEMAKRIEHRNFDFLDINMGCPV
FT                   PKVVNNGEGSALMLKPERIGEIVSAISKAIKKPVTVKIRKGFTKDNINAVEVAKVIEQS
FT                   GGAAIAVHGRTREQYYSGEADWDIIKAVKEAVSIPVIGNGDVQTPEDVKRMMSYTGCDA
FT                   VMIARGVRGNPWFFSQAKHYLNTGEILAKPSVPEVIEMILRHGRLAIEVKGEFTAMHEM
FT                   RKHVAWYTMGYPKSAKLRNQVNEIETYEDLIVLMKKYEEMLDL"
     MSFTIGNVNI NGNLVLGPMA GVTDLPFRLL CKEQGADLIY TEMVSAKGIY YNNKNTEVLL        60
     EVEEKERPVA LQLFGEDPYI MSEMAKRIEH RNFDFLDINM GCPVPKVVNN GEGSALMLKP       120
     ERIGEIVSAI SKAIKKPVTV KIRKGFTKDN INAVEVAKVI EQSGGAAIAV HGRTREQYYS       180
     GEADWDIIKA VKEAVSIPVI GNGDVQTPED VKRMMSYTGC DAVMIARGVR GNPWFFSQAK       240
     HYLNTGEILA KPSVPEVIEM ILRHGRLAIE VKGEFTAMHE MRKHVAWYTM GYPKSAKLRN       300
     QVNEIETYED LIVLMKKYEE MLDL                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page