(data stored in SCRATCH zone)

EMBL: CP000885.PE435

CP000885.PE435       Location/Qualifiers
FT   CDS             559906..560619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0439"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sun:SUN_1062 Mn2+/Zn2+ ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40826"
FT                   /db_xref="GOA:A9KHF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF9"
FT                   /protein_id="ABX40826.1"
FT                   /translation="MALISCSDTVLAYDEKVVVSNLNFHVREGEYLCIVGENGSGKSTL
FT                   IKTILGLKTVSSGTITYGDGIRANEIGYLPQQTEIQKDFPALVKEVVLSGGLNGCGLRP
FT                   FYNKYEKSKARRNMELLNIENLENKCYRELSGGQKQRVLLARALCASKKLLLLDEPVTG
FT                   LDPNATKDMYDLIEKLNKENHVTVLMVSHDISAAVKYATHILHIGNTPLFYGSKGEYLE
FT                   SEIGRIYTGKAGTLL"
     MALISCSDTV LAYDEKVVVS NLNFHVREGE YLCIVGENGS GKSTLIKTIL GLKTVSSGTI        60
     TYGDGIRANE IGYLPQQTEI QKDFPALVKE VVLSGGLNGC GLRPFYNKYE KSKARRNMEL       120
     LNIENLENKC YRELSGGQKQ RVLLARALCA SKKLLLLDEP VTGLDPNATK DMYDLIEKLN       180
     KENHVTVLMV SHDISAAVKY ATHILHIGNT PLFYGSKGEY LESEIGRIYT GKAGTLL          237
//

If you have problems or comments...

PBIL Back to PBIL home page