(data stored in SCRATCH zone)

EMBL: CP000885.PE449

CP000885.PE449       Location/Qualifiers
FT   CDS             577548..578456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40840"
FT                   /db_xref="GOA:A9KHH3"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH3"
FT                   /protein_id="ABX40840.1"
FT                   /translation="MSPFQKIIKYFAMGFAAFLMVGILTSIVAVVSGLGSGIDTYEINK
FT                   NYVSFTKDFDNVKNLNFSNGDKKLTLVSGDTDKVIVEAKNVPDSLEVKVTSDGTLTIKD
FT                   RDRFHISWIIGWSGNWNSDMEIIVTVPRDFTVGKVELDSGSANMEVNDLTADNMIIDGG
FT                   SGSFIGRNLSAKKANISLGSGSTRLDYVKFEKGKMDCGSGDVKIENAIFRDVDFDGGSG
FT                   SISYSGQLSGKTSLNCGSGRISFELEGKREDYNINSDSGSGGIWIDGTRADNYKERNSD
FT                   VNNEIKIDGGSGRVLINFYSE"
     MSPFQKIIKY FAMGFAAFLM VGILTSIVAV VSGLGSGIDT YEINKNYVSF TKDFDNVKNL        60
     NFSNGDKKLT LVSGDTDKVI VEAKNVPDSL EVKVTSDGTL TIKDRDRFHI SWIIGWSGNW       120
     NSDMEIIVTV PRDFTVGKVE LDSGSANMEV NDLTADNMII DGGSGSFIGR NLSAKKANIS       180
     LGSGSTRLDY VKFEKGKMDC GSGDVKIENA IFRDVDFDGG SGSISYSGQL SGKTSLNCGS       240
     GRISFELEGK REDYNINSDS GSGGIWIDGT RADNYKERNS DVNNEIKIDG GSGRVLINFY       300
     SE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page