(data stored in SCRATCH zone)

EMBL: CP000885.PE475

CP000885.PE475       Location/Qualifiers
FT   CDS             608639..609142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0479"
FT                   /product="stage V sporulation protein AC"
FT                   /note="TIGRFAM: stage V sporulation protein AC; PFAM: SpoVA
FT                   protein; KEGG: drm:Dred_1106 SpoVA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40866"
FT                   /db_xref="GOA:A9KI32"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI32"
FT                   /protein_id="ABX40866.1"
FT                   /translation="MANDKNKVSASQVANEKDQQERDKLYNQYVKQVTPKHSWFTNMCK
FT                   AFVSGGIICAIGQGFINFYSSYGAEKELAGAYTTMSLVLLSIIFTGFNWYQKIAKFAGA
FT                   GILVPITGFANSVAAPAIEFKKEGQVFGIGCKIFTIAGPVILYGIFSSWLLGLVYYIFT
FT                   MFQK"
     MANDKNKVSA SQVANEKDQQ ERDKLYNQYV KQVTPKHSWF TNMCKAFVSG GIICAIGQGF        60
     INFYSSYGAE KELAGAYTTM SLVLLSIIFT GFNWYQKIAK FAGAGILVPI TGFANSVAAP       120
     AIEFKKEGQV FGIGCKIFTI AGPVILYGIF SSWLLGLVYY IFTMFQK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page