(data stored in SCRATCH zone)

EMBL: CP000885.PE476

CP000885.PE476       Location/Qualifiers
FT   CDS             609211..610278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0480"
FT                   /product="stage V sporulation protein AD"
FT                   /note="TIGRFAM: stage V sporulation protein AD; PFAM: Stage
FT                   V sporulation AD family protein; KEGG: amt:Amet_2220 stage
FT                   V sporulation AD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40867"
FT                   /db_xref="GOA:A9KI33"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI33"
FT                   /protein_id="ABX40867.1"
FT                   /translation="MTQTTAKQSKMVGKQSVQFSNPPAIIGCASVAGQKEGEGPLGAFF
FT                   DVIEEDPMFGQKTWEEAESKMLGMAVDVAIHNAGLKKSDIRYLVGGDLLGQLIATSFGI
FT                   ENFEIPLIGVYGACSTMGESIVVASMIIDGGFADRTLAITSSHFAGAEKQFRFPLAYGN
FT                   QRPKAASWTVTGSGAVILGHEPEKDSEFAKQFSPVMIKVKGITIGKIVDYGIKDSLNMG
FT                   ACMAPAACETIAQNLKDFSIQPDYYDRIITGDLGMIGKDILIDLLKEKGYDISSNHMDC
FT                   GIEIFDSEAQDTHAGGSGCGCSAITLTGYILQKLRKRDWNRVLFVPTGALLSTVSYNEG
FT                   QSVPGIAHAVMLESC"
     MTQTTAKQSK MVGKQSVQFS NPPAIIGCAS VAGQKEGEGP LGAFFDVIEE DPMFGQKTWE        60
     EAESKMLGMA VDVAIHNAGL KKSDIRYLVG GDLLGQLIAT SFGIENFEIP LIGVYGACST       120
     MGESIVVASM IIDGGFADRT LAITSSHFAG AEKQFRFPLA YGNQRPKAAS WTVTGSGAVI       180
     LGHEPEKDSE FAKQFSPVMI KVKGITIGKI VDYGIKDSLN MGACMAPAAC ETIAQNLKDF       240
     SIQPDYYDRI ITGDLGMIGK DILIDLLKEK GYDISSNHMD CGIEIFDSEA QDTHAGGSGC       300
     GCSAITLTGY ILQKLRKRDW NRVLFVPTGA LLSTVSYNEG QSVPGIAHAV MLESC            355
//

If you have problems or comments...

PBIL Back to PBIL home page