(data stored in SCRATCH zone)

EMBL: CP000885.PE484

CP000885.PE484       Location/Qualifiers
FT   CDS             617267..619552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0488"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   atc:AGR_L_3558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40875"
FT                   /db_xref="GOA:A9KI41"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012364"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032518"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI41"
FT                   /protein_id="ABX40875.1"
FT                   /translation="MTKLIEPKSSILTIGYHPENEKILENPPRFTWMPESEKDILYRIQ
FT                   VSKNDTFDPDSTLTIHHIPYNFYTLDKELEPGDYYWRYTIDQEECSYSKVRKLSISDGL
FT                   VVTPLVSREKRYDNVDMSHPRIWLNKEKIDMFREELEKNPNYCGFQIFLERSVLIHVNS
FT                   EFVAEPPFYPGNIRVVELWRKNYQECQRGLEYIRSLSVAGVLLENSEYIEKAKLALLKL
FT                   ASWDTNGSTARDYNDECSFRVAYALAFGYDWLYSFLTKQERSIILESLSVRTRQVATHI
FT                   IKDSRIHLSLYDSHAVRSLSSVLTPCCIAMLGESAEAKEWLDYTIEYFNTIYTPWGGED
FT                   GGWAEGGLYWTTGMAFVSEALNTIKSFLNIDIYKRPFFQKTGDFPLYCMPVDTYRASFC
FT                   DQSNLGKYPGHKTAYNIRQFAGVTGNQNYQWYYEQVLEREKEIDQDFFNKGWWDFYFDD
FT                   MVYRHDYKDTTLKEEKLERVKWFKDIGWVAINKDMKDPKEHIFLLTKSSPYGSVSHSHG
FT                   DQNSFVLFAYGEPLIIKSGYYIGFNTTMHRNFRRQTLSHNSILINGKGQYAGMDKAKQL
FT                   SAKGHICEVKESDNLVYIKEDATAAYQLTAPELTKYTREIYFVDDSYFILVDTVESEDK
FT                   SDVEWLLHSLSKFQIEEETIEVNGKMAGMTAKIVYCSSNIESITQSDIFTEVDEKETDG
FT                   LDNQWHLTMKTGKAKKHIIVSVIVPYKMEQKKLVNSVRDDQGMDIYLYFSYEGKTFSLC
FT                   IDGTKRNE"
     MTKLIEPKSS ILTIGYHPEN EKILENPPRF TWMPESEKDI LYRIQVSKND TFDPDSTLTI        60
     HHIPYNFYTL DKELEPGDYY WRYTIDQEEC SYSKVRKLSI SDGLVVTPLV SREKRYDNVD       120
     MSHPRIWLNK EKIDMFREEL EKNPNYCGFQ IFLERSVLIH VNSEFVAEPP FYPGNIRVVE       180
     LWRKNYQECQ RGLEYIRSLS VAGVLLENSE YIEKAKLALL KLASWDTNGS TARDYNDECS       240
     FRVAYALAFG YDWLYSFLTK QERSIILESL SVRTRQVATH IIKDSRIHLS LYDSHAVRSL       300
     SSVLTPCCIA MLGESAEAKE WLDYTIEYFN TIYTPWGGED GGWAEGGLYW TTGMAFVSEA       360
     LNTIKSFLNI DIYKRPFFQK TGDFPLYCMP VDTYRASFCD QSNLGKYPGH KTAYNIRQFA       420
     GVTGNQNYQW YYEQVLEREK EIDQDFFNKG WWDFYFDDMV YRHDYKDTTL KEEKLERVKW       480
     FKDIGWVAIN KDMKDPKEHI FLLTKSSPYG SVSHSHGDQN SFVLFAYGEP LIIKSGYYIG       540
     FNTTMHRNFR RQTLSHNSIL INGKGQYAGM DKAKQLSAKG HICEVKESDN LVYIKEDATA       600
     AYQLTAPELT KYTREIYFVD DSYFILVDTV ESEDKSDVEW LLHSLSKFQI EEETIEVNGK       660
     MAGMTAKIVY CSSNIESITQ SDIFTEVDEK ETDGLDNQWH LTMKTGKAKK HIIVSVIVPY       720
     KMEQKKLVNS VRDDQGMDIY LYFSYEGKTF SLCIDGTKRN E                           761
//

If you have problems or comments...

PBIL Back to PBIL home page