(data stored in SCRATCH zone)

EMBL: CP000885.PE493

CP000885.PE493       Location/Qualifiers
FT   CDS             complement(635568..638291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0497"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   cno:NT01CX_1810 penicillin-binding protein 1A/1B"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40884"
FT                   /db_xref="GOA:A9KI50"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI50"
FT                   /protein_id="ABX40884.1"
FT                   /translation="MDFSRKGVIKKQRNIKSTSKRLNTKIRITLFRVSMISIVCLGIVG
FT                   VIAISGAMKGIIGSAPDIGQVNIDPEGFASYIYYSDGTLAQKLIGAESNRVLVSIDKIP
FT                   DVLQHAFVALEDERFYEHDGIDVYGIFRAGFSVLKTKDLGFGGSTITQQLIKAKVFNYG
FT                   NEPNAVDKIVRKIQEQYLAIKLEDIYTKDEILEAYLNNINLGNGTYGVQTAAQSYFGKD
FT                   VSELTLSEASVIAPIALSPVFRNPINYPAMNAERRQSCLDNMLRLGYITQKDYDAALAD
FT                   DVYSRIKQYNEEKAPSTYYSYFTDAVINQVLSDLQTKKGYTQDDASYMLFSNGLKIFST
FT                   QDKTIQGIVDKYFQDESNFPAIGEGSYYEMKYELSVYDDEDNATHYHFNDMLEYFKDFK
FT                   DTEGLYFHEPYTPKVGINSLGYSKEDMEAKIEEFRNSKVKENQVYVEKKEITLQPQTSM
FT                   TIMDQHNGNVVALYGGRGTKTGNRTTNRASSSKRQVGSTFKVLASFLPALDSGRYTLAS
FT                   VMDDSEYTYPNGKDTVTNWNKKYKGLSTMREGIYNSMNIIACRFMEAVTPRKGFDYLTS
FT                   LGFDLVELKVKNGKTYTDIGVSLALGGITDGVTNVELTAGYAAIANGGVYNEPIYYTKV
FT                   VDQNGKVILSNEPSSKQVMYTSTAWLLTNAMEDTIKRGTATSIGFRNYSMPIAGKTGTS
FT                   TKDYDLWFVGYTPYYTSAIWTGFDYNFPQKEKSYHKVMWRNIMEEIHSTLKLENKAFVK
FT                   PDSIVTARICTKSGQLAVPGLCDKALSGDCTRTEYFAKGTVPTQTCTVHQKVSICKVSG
FT                   YFASPYCPLDSLVEKVFLIKDEKGSTDDKPYLLPTGDITNPCPIHSEGTVAPPTDEEDN
FT                   ETPIEPENPDDGNENPVEPTTTPPPVIIIPPTDNQP"
     MDFSRKGVIK KQRNIKSTSK RLNTKIRITL FRVSMISIVC LGIVGVIAIS GAMKGIIGSA        60
     PDIGQVNIDP EGFASYIYYS DGTLAQKLIG AESNRVLVSI DKIPDVLQHA FVALEDERFY       120
     EHDGIDVYGI FRAGFSVLKT KDLGFGGSTI TQQLIKAKVF NYGNEPNAVD KIVRKIQEQY       180
     LAIKLEDIYT KDEILEAYLN NINLGNGTYG VQTAAQSYFG KDVSELTLSE ASVIAPIALS       240
     PVFRNPINYP AMNAERRQSC LDNMLRLGYI TQKDYDAALA DDVYSRIKQY NEEKAPSTYY       300
     SYFTDAVINQ VLSDLQTKKG YTQDDASYML FSNGLKIFST QDKTIQGIVD KYFQDESNFP       360
     AIGEGSYYEM KYELSVYDDE DNATHYHFND MLEYFKDFKD TEGLYFHEPY TPKVGINSLG       420
     YSKEDMEAKI EEFRNSKVKE NQVYVEKKEI TLQPQTSMTI MDQHNGNVVA LYGGRGTKTG       480
     NRTTNRASSS KRQVGSTFKV LASFLPALDS GRYTLASVMD DSEYTYPNGK DTVTNWNKKY       540
     KGLSTMREGI YNSMNIIACR FMEAVTPRKG FDYLTSLGFD LVELKVKNGK TYTDIGVSLA       600
     LGGITDGVTN VELTAGYAAI ANGGVYNEPI YYTKVVDQNG KVILSNEPSS KQVMYTSTAW       660
     LLTNAMEDTI KRGTATSIGF RNYSMPIAGK TGTSTKDYDL WFVGYTPYYT SAIWTGFDYN       720
     FPQKEKSYHK VMWRNIMEEI HSTLKLENKA FVKPDSIVTA RICTKSGQLA VPGLCDKALS       780
     GDCTRTEYFA KGTVPTQTCT VHQKVSICKV SGYFASPYCP LDSLVEKVFL IKDEKGSTDD       840
     KPYLLPTGDI TNPCPIHSEG TVAPPTDEED NETPIEPENP DDGNENPVEP TTTPPPVIII       900
     PPTDNQP                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page