(data stored in SCRATCH zone)

EMBL: CP000885.PE501

CP000885.PE501       Location/Qualifiers
FT   CDS             646539..647039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT_4765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40892"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI58"
FT                   /protein_id="ABX40892.1"
FT                   /translation="MPNIAIMKISTYHKAQGHDVDWYNPVIDIMDTDILYECQLFNFTA
FT                   PYQYYPVRAKIIRGGTGVDIKSHLPKEIEQILELDYSLYPDCDYSMQFFSRGCIRNCHF
FT                   CVVRDKEGYIHEVEPMLLNPKGKHIEVLDNNFFANPNWNKAVDYIINTGQKVSLHGVDY
FT                   GYL"
     MPNIAIMKIS TYHKAQGHDV DWYNPVIDIM DTDILYECQL FNFTAPYQYY PVRAKIIRGG        60
     TGVDIKSHLP KEIEQILELD YSLYPDCDYS MQFFSRGCIR NCHFCVVRDK EGYIHEVEPM       120
     LLNPKGKHIE VLDNNFFANP NWNKAVDYII NTGQKVSLHG VDYGYL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page