(data stored in SCRATCH zone)

EMBL: CP000885.PE505

CP000885.PE505       Location/Qualifiers
FT   CDS             complement(650047..650415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0509"
FT                   /product="membrane protein"
FT                   /note="KEGG: cac:CAC1316 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40896"
FT                   /db_xref="GOA:A9KI62"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI62"
FT                   /protein_id="ABX40896.1"
FT                   /translation="MKTARLVIGIISMVLFAFVSFQSCAAGVGNALVNNGESSGSAGML
FT                   IAFCFLIAGIVGVATRNKGKGGPMTAGVFYALGGIMGLATSSTLYGDLKIWAILSLIFA
FT                   AVFILGALKQKTENVPNA"
     MKTARLVIGI ISMVLFAFVS FQSCAAGVGN ALVNNGESSG SAGMLIAFCF LIAGIVGVAT        60
     RNKGKGGPMT AGVFYALGGI MGLATSSTLY GDLKIWAILS LIFAAVFILG ALKQKTENVP       120
     NA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page