(data stored in SCRATCH zone)

EMBL: CP000885.PE51

CP000885.PE51        Location/Qualifiers
FT   CDS             70537..71733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40442"
FT                   /db_xref="GOA:A9KQD3"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD3"
FT                   /protein_id="ABX40442.1"
FT                   /translation="MERLKRSLRADELNLKKKKKRRLILSLGVIGILIILGIAIVLHRK
FT                   TAVYTSYKVVGSTELTNAKESSYLKYKNGVIKYNRDGAEAIGADGTVLWNVSYSMKKPI
FT                   INVRGSYAAIADMGSYDLVIVNGSGTTNALTMKEPIAAVKIASQGVTAVLTGNGTTDYI
FT                   YFYDMNSENGKSILDVKTMVTTDGFPTDIGISEDGTKLVTSYLAVDDDNDGVVSKVTFY
FT                   NFGEYGKNQVDNLVGFYSDYRGEVIPKVEFLNNEIVAAFRDTGITLYSIKEVPREIMRQ
FT                   TYTEKIHSICYNDMYVGVILDGTNNTQERKVLLYDFSGKKILEKEVNFTFQNVTLIENQ
FT                   IIFYSSTECNIMNIDGSMKFSSQFHTNVTSLYQTSSMNEYLLVTDVGLDKIQLNKSEE"
     MERLKRSLRA DELNLKKKKK RRLILSLGVI GILIILGIAI VLHRKTAVYT SYKVVGSTEL        60
     TNAKESSYLK YKNGVIKYNR DGAEAIGADG TVLWNVSYSM KKPIINVRGS YAAIADMGSY       120
     DLVIVNGSGT TNALTMKEPI AAVKIASQGV TAVLTGNGTT DYIYFYDMNS ENGKSILDVK       180
     TMVTTDGFPT DIGISEDGTK LVTSYLAVDD DNDGVVSKVT FYNFGEYGKN QVDNLVGFYS       240
     DYRGEVIPKV EFLNNEIVAA FRDTGITLYS IKEVPREIMR QTYTEKIHSI CYNDMYVGVI       300
     LDGTNNTQER KVLLYDFSGK KILEKEVNFT FQNVTLIENQ IIFYSSTECN IMNIDGSMKF       360
     SSQFHTNVTS LYQTSSMNEY LLVTDVGLDK IQLNKSEE                               398
//

If you have problems or comments...

PBIL Back to PBIL home page