(data stored in SCRATCH zone)

EMBL: CP000885.PE53

CP000885.PE53        Location/Qualifiers
FT   CDS             72635..73597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0054"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: tde:TDE0157 KHG/KDPG family
FT                   aldolase/carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40444"
FT                   /db_xref="GOA:A9KQD5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD5"
FT                   /protein_id="ABX40444.1"
FT                   /translation="MNEVLKRFEQLGIIPVVKIDDAKDAAPLAKALCEGGLPVAEVTFR
FT                   TAAAEEAIRNMVEACPDMFVGAGTVLTTEQVDRAIAAGCKFIVSPGLNPKIVKYCIEKG
FT                   IPITPGTSSPTDIEQAIELGLEAVKFFPAEASGGLAKIKAMAAPYVNMRFMPTGGISEK
FT                   NLTSYLDFPKILACGGSWMVSEALINGGKFDEIKKLTREAVNTMLGFELKHVGINATSE
FT                   EEADGVATSFEKLFGFTKNVGSSSIFAGSAIEVMKTPYLGAHGHIAIQTNYIERAIYHM
FT                   ELQGFEFDMDTAKYNGGKMVAVYLKGELGGFAVHLLQKK"
     MNEVLKRFEQ LGIIPVVKID DAKDAAPLAK ALCEGGLPVA EVTFRTAAAE EAIRNMVEAC        60
     PDMFVGAGTV LTTEQVDRAI AAGCKFIVSP GLNPKIVKYC IEKGIPITPG TSSPTDIEQA       120
     IELGLEAVKF FPAEASGGLA KIKAMAAPYV NMRFMPTGGI SEKNLTSYLD FPKILACGGS       180
     WMVSEALING GKFDEIKKLT REAVNTMLGF ELKHVGINAT SEEEADGVAT SFEKLFGFTK       240
     NVGSSSIFAG SAIEVMKTPY LGAHGHIAIQ TNYIERAIYH MELQGFEFDM DTAKYNGGKM       300
     VAVYLKGELG GFAVHLLQKK                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page