(data stored in SCRATCH zone)

EMBL: CP000885.PE535

CP000885.PE535       Location/Qualifiers
FT   CDS             complement(688261..689655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0539"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   cdf:CD0551 putative spore cortex-lytic enzyme pre-pro-form
FT                   (putative spore peptidoglycan hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40926"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI92"
FT                   /protein_id="ABX40926.1"
FT                   /translation="MVYNPYSFRYPTFREGLGLEKDVFSPTMDNQIPRTNMMPRNDYRV
FT                   YPAQVETQSLGGLVVDVLSARDNRPISNATVGIQFTGDPSTQPIEELQTSDTGRTELVE
FT                   LPAPPVDYSLEPSAPMPYSEYTLTIKAPGFEPVIITGAQILPTVNALQNILLDPTPSAG
FT                   VRNTAEAFVIPYHTLYGDYPPKILEDEIKPLEEAGEIVLPNVVIPEFIVVHDGVPTDKT
FT                   AKDYWVPYRDYIKNVASSEIYATWPESTIYANVLAIQSFTLNRVFTEWYRNKGFSFTIT
FT                   SSTAYDHKFMPGRNFFDSISRVVDTIFNNYLSRPNVKQPILTQYCDGKRVSCPEVMTQW
FT                   GSKTLGDQGYTPIQILRYYYGDSIYINTTYEVSGVPVSFPGYNLTIGSSGSSVMQLQEQ
FT                   LNAIADVYYPIPNVSADGIFGPATAAAVKAFQKQFNLPQSGIVDLPTWYKISGIYVAIT
FT                   RMAEYQ"
     MVYNPYSFRY PTFREGLGLE KDVFSPTMDN QIPRTNMMPR NDYRVYPAQV ETQSLGGLVV        60
     DVLSARDNRP ISNATVGIQF TGDPSTQPIE ELQTSDTGRT ELVELPAPPV DYSLEPSAPM       120
     PYSEYTLTIK APGFEPVIIT GAQILPTVNA LQNILLDPTP SAGVRNTAEA FVIPYHTLYG       180
     DYPPKILEDE IKPLEEAGEI VLPNVVIPEF IVVHDGVPTD KTAKDYWVPY RDYIKNVASS       240
     EIYATWPEST IYANVLAIQS FTLNRVFTEW YRNKGFSFTI TSSTAYDHKF MPGRNFFDSI       300
     SRVVDTIFNN YLSRPNVKQP ILTQYCDGKR VSCPEVMTQW GSKTLGDQGY TPIQILRYYY       360
     GDSIYINTTY EVSGVPVSFP GYNLTIGSSG SSVMQLQEQL NAIADVYYPI PNVSADGIFG       420
     PATAAAVKAF QKQFNLPQSG IVDLPTWYKI SGIYVAITRM AEYQ                        464
//

If you have problems or comments...

PBIL Back to PBIL home page