(data stored in SCRATCH zone)

EMBL: CP000885.PE573

CP000885.PE573       Location/Qualifiers
FT   CDS             741481..743652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cpr:CPR_0537 conserved hypothetical protein TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40964"
FT                   /db_xref="GOA:A9KIW5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIW5"
FT                   /protein_id="ABX40964.1"
FT                   /translation="MKKDTMLAGRVTIPTDVDVVPETMELLNRWGADAIRDCDGTDYPE
FT                   ELKAVQAKVYSTYYTTRKDNAWAKAHPEEVQQCYIMTSFYTATETTLRIPLLKGIAKEL
FT                   MMVNNYDDKVRWWEVIDRSTAMVVSTDTWSYDKETGEVIITNCEPFHNYTVSFLAYLIW
FT                   DPVHMYNAVVNGWQGVEHQITFDVRQPKTREYSMVRLRKFIEEHPYVDVIRYTTFFHQF
FT                   TLVFDEMMREKYVDWYGYSASVSPYILEQFEKEVGYRFRPEFIIDQGYYNNQYRIPSKE
FT                   FKDFQAFQRREVAKLAKEMVDITHEYGKEAMMFLGDHWIGTEPFMEEFKTIGLDAVVGS
FT                   VGNGSTLRLISDIPGVKYTEGRFLPYFFPDTFHEGGDPVKEAKVNWVTARRAILRKPID
FT                   RIGYGGYLKLACQFPEFIDYVESVCNEFRELYENIKGTTPFCIKRVAVLNSWGKMRAWG
FT                   AHMVHHALYQKQNYSYAGVIESLSGTPFEVSFISFDDIKKDKNILKNIDVIINVGDGDT
FT                   AHTGGLVWEDADISSAIHQFVYEGGGLIGIGEPTGHQYQGRYIQLANVFGIEKETGFTL
FT                   NYDKYNWDAVESHFITEDCTKEVDFGEGKKNMYALEGTTILVQMEKEVQMAVNEFGKGR
FT                   SVYLSGLPYSFENSRVLYRSILWSAHEEENLHKWYSSNFNVEVHAYVKNNKYCVVNNTY
FT                   EPQNTTIYRGDSSSFDLELEANEIIWYEI"
     MKKDTMLAGR VTIPTDVDVV PETMELLNRW GADAIRDCDG TDYPEELKAV QAKVYSTYYT        60
     TRKDNAWAKA HPEEVQQCYI MTSFYTATET TLRIPLLKGI AKELMMVNNY DDKVRWWEVI       120
     DRSTAMVVST DTWSYDKETG EVIITNCEPF HNYTVSFLAY LIWDPVHMYN AVVNGWQGVE       180
     HQITFDVRQP KTREYSMVRL RKFIEEHPYV DVIRYTTFFH QFTLVFDEMM REKYVDWYGY       240
     SASVSPYILE QFEKEVGYRF RPEFIIDQGY YNNQYRIPSK EFKDFQAFQR REVAKLAKEM       300
     VDITHEYGKE AMMFLGDHWI GTEPFMEEFK TIGLDAVVGS VGNGSTLRLI SDIPGVKYTE       360
     GRFLPYFFPD TFHEGGDPVK EAKVNWVTAR RAILRKPIDR IGYGGYLKLA CQFPEFIDYV       420
     ESVCNEFREL YENIKGTTPF CIKRVAVLNS WGKMRAWGAH MVHHALYQKQ NYSYAGVIES       480
     LSGTPFEVSF ISFDDIKKDK NILKNIDVII NVGDGDTAHT GGLVWEDADI SSAIHQFVYE       540
     GGGLIGIGEP TGHQYQGRYI QLANVFGIEK ETGFTLNYDK YNWDAVESHF ITEDCTKEVD       600
     FGEGKKNMYA LEGTTILVQM EKEVQMAVNE FGKGRSVYLS GLPYSFENSR VLYRSILWSA       660
     HEEENLHKWY SSNFNVEVHA YVKNNKYCVV NNTYEPQNTT IYRGDSSSFD LELEANEIIW       720
     YEI                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page