(data stored in SCRATCH zone)

EMBL: CP000885.PE6

CP000885.PE6         Location/Qualifiers
FT   CDS             6932..9631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: amt:Amet_0007 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40397"
FT                   /db_xref="GOA:A9KPP6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP6"
FT                   /protein_id="ABX40397.1"
FT                   /translation="MDENIFDKVHDVDLKKTMETSYIEYAMSVIAARALPDVRDGLKPV
FT                   QRRILYAMIELNNGPDKPHRKCARIVGDTMGKYHPHGDSSIYGALVNLAQEWSTRYPLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISMEMLSDINKDTVDFAPNFDETEKEPLVLPAR
FT                   YPNLLVNGTSGIAVGMATNIPPHNMREIIGAVVRIIDNKIEEKETTIEELLEIVKGPDF
FT                   PTGAMILGTRGIEEAYRTGRGKIRVRAVTNIEPMANGKNRIIVTELPYMVNKARLIEKI
FT                   AELVRDKKIDGITELRDESDREGMRICIELRRDVNANVILNQLYKHTQLQDTFGVIMLA
FT                   LVNNQPKVLTLLEMLSYYLKHQEEVVTRRITYDLNKAKERAHILEGLLKALDFIDEVIN
FT                   IIRASKNGAMAKERLIERFEFDDIQAQAIIDMRLRALTGLEREKLQDEFAELQRRIAEF
FT                   EAILADEKLLLGVIKGEIQVINDKFGDERRTSIGFDEFDISMEDLIPDENTVIAMTRLG
FT                   YIKRMTIDNFKSQHRGGKGIKGMQTIDEDFIEDLFMTTTHHYIMFFTNKGRVYRLKAYE
FT                   IPESSRTARGTAIVNLLQLLPEERITAIIALKEYKDNRYLFMATKDGIVKKTKIKEYQN
FT                   IRKTGLQAINLREDDELIEVKTTNSQKDIVLVTKNGMCIRFHEKDVRNTGRASMGVIGM
FT                   NLTNGDEVVAMQIHTQGKYLLTVSEYGLGKLTDLDEFTPQRRGGKGVKCYKITEKTGNV
FT                   VGAKAVNEEHEVMIITNEGIIIRLEVNGISILGRITSGVKLINIDAGKDIRVASLAKVK
FT                   ESSMNSEEDVLKKLEEELKEENVVIPPEDDQEEEEYSEEDDSFEGDNSLEEEDLMDDTK
FT                   DLEELVSRALKDQEEQEDQEKQEEDQED"
     MDENIFDKVH DVDLKKTMET SYIEYAMSVI AARALPDVRD GLKPVQRRIL YAMIELNNGP        60
     DKPHRKCARI VGDTMGKYHP HGDSSIYGAL VNLAQEWSTR YPLVDGHGNF GSVDGDGAAA       120
     MRYTEARLSK ISMEMLSDIN KDTVDFAPNF DETEKEPLVL PARYPNLLVN GTSGIAVGMA       180
     TNIPPHNMRE IIGAVVRIID NKIEEKETTI EELLEIVKGP DFPTGAMILG TRGIEEAYRT       240
     GRGKIRVRAV TNIEPMANGK NRIIVTELPY MVNKARLIEK IAELVRDKKI DGITELRDES       300
     DREGMRICIE LRRDVNANVI LNQLYKHTQL QDTFGVIMLA LVNNQPKVLT LLEMLSYYLK       360
     HQEEVVTRRI TYDLNKAKER AHILEGLLKA LDFIDEVINI IRASKNGAMA KERLIERFEF       420
     DDIQAQAIID MRLRALTGLE REKLQDEFAE LQRRIAEFEA ILADEKLLLG VIKGEIQVIN       480
     DKFGDERRTS IGFDEFDISM EDLIPDENTV IAMTRLGYIK RMTIDNFKSQ HRGGKGIKGM       540
     QTIDEDFIED LFMTTTHHYI MFFTNKGRVY RLKAYEIPES SRTARGTAIV NLLQLLPEER       600
     ITAIIALKEY KDNRYLFMAT KDGIVKKTKI KEYQNIRKTG LQAINLREDD ELIEVKTTNS       660
     QKDIVLVTKN GMCIRFHEKD VRNTGRASMG VIGMNLTNGD EVVAMQIHTQ GKYLLTVSEY       720
     GLGKLTDLDE FTPQRRGGKG VKCYKITEKT GNVVGAKAVN EEHEVMIITN EGIIIRLEVN       780
     GISILGRITS GVKLINIDAG KDIRVASLAK VKESSMNSEE DVLKKLEEEL KEENVVIPPE       840
     DDQEEEEYSE EDDSFEGDNS LEEEDLMDDT KDLEELVSRA LKDQEEQEDQ EKQEEDQED        899
//

If you have problems or comments...

PBIL Back to PBIL home page