(data stored in SCRATCH zone)

EMBL: CP000885.PE71

CP000885.PE71        Location/Qualifiers
FT   CDS             102256..103299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40462"
FT                   /db_xref="GOA:A9KQF3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF3"
FT                   /protein_id="ABX40462.1"
FT                   /translation="MRITRGKKEKSAEIIGWRKKLLFGCVFLLATLVLAVVFAPFILVY
FT                   YITRGPVLYQVEASFDHPLQEVYKASDFLLEDKMLPIRTQDGFSLWASEIEVENPKAIV
FT                   IYLTDLKQPSITYFYGHAKWMKDNGYASILLETRGHGESDGDVIGLGYTEVNDVKAVVE
FT                   YIQKQECYRDVPIVLQGFSMGGAVAINAFGQIPEIDALIAMSAYTSTEDAMIDSMRDHG
FT                   VPEFLCKIERPLIKFALSIVFGRDAVETLKPIEQIKNANDRPVFFISSKEDLKVSLENI
FT                   RRFREVNPEAEYWVRDSAAHLDIDDNDFTNVEKDTEYCNRILDFLDKVKKAKQNVLSMT
FT                   KKAYFLL"
     MRITRGKKEK SAEIIGWRKK LLFGCVFLLA TLVLAVVFAP FILVYYITRG PVLYQVEASF        60
     DHPLQEVYKA SDFLLEDKML PIRTQDGFSL WASEIEVENP KAIVIYLTDL KQPSITYFYG       120
     HAKWMKDNGY ASILLETRGH GESDGDVIGL GYTEVNDVKA VVEYIQKQEC YRDVPIVLQG       180
     FSMGGAVAIN AFGQIPEIDA LIAMSAYTST EDAMIDSMRD HGVPEFLCKI ERPLIKFALS       240
     IVFGRDAVET LKPIEQIKNA NDRPVFFISS KEDLKVSLEN IRRFREVNPE AEYWVRDSAA       300
     HLDIDDNDFT NVEKDTEYCN RILDFLDKVK KAKQNVLSMT KKAYFLL                     347
//

If you have problems or comments...

PBIL Back to PBIL home page