(data stored in SCRATCH zone)

EMBL: CP000885.PE78

CP000885.PE78        Location/Qualifiers
FT   CDS             108728..109885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0079"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: bld:BLi04006 YxjM"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40469"
FT                   /db_xref="GOA:A9KQG0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG0"
FT                   /protein_id="ABX40469.1"
FT                   /translation="MNENIIRYQFVLIKGLLLGAVFLYHVMEQQNKLLSQYGVWVIYAL
FT                   LFAALIAQGITKRHKALLLLIQTGLVIVMISWFGREYALVLPVIFLSIAGSLKIRYPYY
FT                   ATAILGAFVYSGNIAVYLLFTFVCILLFIQNDVIIDKYKNLLQSYEQNEQRLKHSMDNQ
FT                   SHIYKKELIENSLFFENKLLEEKGRLSQALHDKLGHSINGSIYQLEATKVLLTSEPEQA
FT                   NGILQAVIDNLRISMDEIRQLLRGEKPDKRKMALLQLMTLCDECKKKYNIEAEVIMSGD
FT                   NKSVPEYIWEVILDNSFEAVSNALKYSKCKHITIQIVILNKLVRCTIEDDGVGCMQINE
FT                   GMGIAGMRKRVRAINGVLDVTAQIGFCINMILPISTLYNNARSEK"
     MNENIIRYQF VLIKGLLLGA VFLYHVMEQQ NKLLSQYGVW VIYALLFAAL IAQGITKRHK        60
     ALLLLIQTGL VIVMISWFGR EYALVLPVIF LSIAGSLKIR YPYYATAILG AFVYSGNIAV       120
     YLLFTFVCIL LFIQNDVIID KYKNLLQSYE QNEQRLKHSM DNQSHIYKKE LIENSLFFEN       180
     KLLEEKGRLS QALHDKLGHS INGSIYQLEA TKVLLTSEPE QANGILQAVI DNLRISMDEI       240
     RQLLRGEKPD KRKMALLQLM TLCDECKKKY NIEAEVIMSG DNKSVPEYIW EVILDNSFEA       300
     VSNALKYSKC KHITIQIVIL NKLVRCTIED DGVGCMQINE GMGIAGMRKR VRAINGVLDV       360
     TAQIGFCINM ILPISTLYNN ARSEK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page