(data stored in SCRATCH zone)

EMBL: CP000885.PE80

CP000885.PE80        Location/Qualifiers
FT   CDS             110768..111313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0081"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: cbe:Cbei_2490 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40471"
FT                   /db_xref="GOA:A9KQG2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG2"
FT                   /protein_id="ABX40471.1"
FT                   /translation="MKKFVCSVCGYVHEGDSAPDKCPICNADSSKFIEKSGELQWADEH
FT                   VIGISSDANDEILEGLRANFMGECTEVGMYIAMSRQADREGYPEVAEAYKRIEYEEADH
FT                   ASRFAEMLGEVVKASTSDNLAARVDAEYGACEGKKKLATLAKSMNLDAIHDSVHEMAKD
FT                   EARHGCAFKGLLDRYFGK"
     MKKFVCSVCG YVHEGDSAPD KCPICNADSS KFIEKSGELQ WADEHVIGIS SDANDEILEG        60
     LRANFMGECT EVGMYIAMSR QADREGYPEV AEAYKRIEYE EADHASRFAE MLGEVVKAST       120
     SDNLAARVDA EYGACEGKKK LATLAKSMNL DAIHDSVHEM AKDEARHGCA FKGLLDRYFG       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page