(data stored in SCRATCH zone)

EMBL: CP000885.PE89

CP000885.PE89        Location/Qualifiers
FT   CDS             complement(120033..121487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0090"
FT                   /product="Ferredoxin hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; hydrogenase large subunit domain protein; KEGG:
FT                   cbe:Cbei_0327 ferredoxin hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40480"
FT                   /db_xref="GOA:A9KQH1"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH1"
FT                   /protein_id="ABX40480.1"
FT                   /translation="MLQTDNDIGTIKHEVLFEVAKLAFKNQLADKEDVLPYEMIPGPQA
FT                   NFRCCVYKEREIIRQRIRLAQGKSPSLSHDSSNIVQVISSACEECPITRFLVTDNCQKC
FT                   MGKRCQKACNFQAISMSHDRAHIDPAKCKECGMCASACPYNAIADLKRPCKKSCPVDAI
FT                   SMDENNIVVIDEEKCINCGQCINNCPFGAISDRSFMVDVINLLSIDKPIYAMIAPAIEG
FT                   QFGATATTGVMTEALKQLGFTGVYEVALGADLVAASEAEEWAEAYKEGMKKTTSCCPAF
FT                   VKMIKNHYPSLVEHISSTISPMQATAKYIKAIHEDAITVFIGPCIAKKGEVLDHIAEGG
FT                   ADYALTFDELYAMLRAKDINLETIGENIQQGSIFAKNFAVAGGVTASVVEALKEKGIDA
FT                   PITVAGCNGAAECKKALTLLKVGKFPEDFMEGMCCEGGCVNGPGSILTGRFAAKNRAKL
FT                   LSSADDRKIYDTVDSCQDLNIQMHRH"
     MLQTDNDIGT IKHEVLFEVA KLAFKNQLAD KEDVLPYEMI PGPQANFRCC VYKEREIIRQ        60
     RIRLAQGKSP SLSHDSSNIV QVISSACEEC PITRFLVTDN CQKCMGKRCQ KACNFQAISM       120
     SHDRAHIDPA KCKECGMCAS ACPYNAIADL KRPCKKSCPV DAISMDENNI VVIDEEKCIN       180
     CGQCINNCPF GAISDRSFMV DVINLLSIDK PIYAMIAPAI EGQFGATATT GVMTEALKQL       240
     GFTGVYEVAL GADLVAASEA EEWAEAYKEG MKKTTSCCPA FVKMIKNHYP SLVEHISSTI       300
     SPMQATAKYI KAIHEDAITV FIGPCIAKKG EVLDHIAEGG ADYALTFDEL YAMLRAKDIN       360
     LETIGENIQQ GSIFAKNFAV AGGVTASVVE ALKEKGIDAP ITVAGCNGAA ECKKALTLLK       420
     VGKFPEDFME GMCCEGGCVN GPGSILTGRF AAKNRAKLLS SADDRKIYDT VDSCQDLNIQ       480
     MHRH                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page