(data stored in SCRATCH zone)

EMBL: CP000885.PE9

CP000885.PE9         Location/Qualifiers
FT   CDS             11434..11871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0009"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   csc:Csac_2255 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40400"
FT                   /db_xref="GOA:A9KPP9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP9"
FT                   /protein_id="ABX40400.1"
FT                   /translation="MKISTKGRYALRLMLDLAINNTGEFITIKSIAGRQEISDKYLEQI
FT                   ITLLSRAGYVKSSRGAQGGYRLTKEPKEYTVGMILKLIEGSLAPVSCVEEEDNDCNRYG
FT                   SCATLFVYQKINEAVNNVVDNITLEDLVERHRELGENNYVI"
     MKISTKGRYA LRLMLDLAIN NTGEFITIKS IAGRQEISDK YLEQIITLLS RAGYVKSSRG        60
     AQGGYRLTKE PKEYTVGMIL KLIEGSLAPV SCVEEEDNDC NRYGSCATLF VYQKINEAVN       120
     NVVDNITLED LVERHRELGE NNYVI                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page