(data stored in SCRATCH zone)

EMBL: CP000885.PE93

CP000885.PE93        Location/Qualifiers
FT   CDS             complement(124837..125703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0094"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein; KEGG: oih:OB2518
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40484"
FT                   /db_xref="GOA:A9KQH5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH5"
FT                   /protein_id="ABX40484.1"
FT                   /translation="MNPTHRKELMIRIISDTSTLYSVSEAEEKGIYVSPLAVTINDTTY
FT                   EEFNDIQTEEFVDLIHQGHIPLSSQPAIGRVVDLYNRFPEDEILNITMADGLSGTYQSA
FT                   ILAKDMAKDSERITVLNSKTLCGPHRTLVEHAKHLADQNHTISEIVSKLEKMIASSRSF
FT                   LIPQDFDYLRRGGRLSHLAAFVGKTIHLVPVMTLTKDCKQLCNFSIKRNFKKAIHEIIR
FT                   SLEDDNIGEHHKLYVSHSLAESLAITASELLKEAFPHSDVIIYKLSPAFTTQGGPGCIA
FT                   IQSLSME"
     MNPTHRKELM IRIISDTSTL YSVSEAEEKG IYVSPLAVTI NDTTYEEFND IQTEEFVDLI        60
     HQGHIPLSSQ PAIGRVVDLY NRFPEDEILN ITMADGLSGT YQSAILAKDM AKDSERITVL       120
     NSKTLCGPHR TLVEHAKHLA DQNHTISEIV SKLEKMIASS RSFLIPQDFD YLRRGGRLSH       180
     LAAFVGKTIH LVPVMTLTKD CKQLCNFSIK RNFKKAIHEI IRSLEDDNIG EHHKLYVSHS       240
     LAESLAITAS ELLKEAFPHS DVIIYKLSPA FTTQGGPGCI AIQSLSME                    288
//

If you have problems or comments...

PBIL Back to PBIL home page