(data stored in ACNUC9435 zone)

EMBL: CP000904.PE1

CP000904.PE1         Location/Qualifiers
FT   CDS             5..1597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ3"
FT                   /protein_id="ABY46425.1"
FT                   /translation="MTLLLNKHTTSMMSMLPQWMKMAKDPKSVGALFLDAFGVELSEIE
FT                   RYIEQAWNDMYIGTTNLQKADYCYKIPLATRDVVDIETLDLHVRLVIDGVRRDCMPADT
FT                   LRLFFESDDNSYMIDTIEGYVYIKVMDYYMKDNIFKPFDAIEVGDTLHYEYMLHHIWNV
FT                   FDEFGMLLGISRLPGERNGDFKNRILDVFKNPGGATKQGLINGISRELGIDKSEVKLGS
FT                   LSDDKYVQTKLMNTDGTPSETYIQYVNQINSNLGFSWDHMNWGEAYWRSIEENNMGFHY
FT                   LPHIWDGFSASWKDNEVQSGIGSGDDLLVTAPKEESPVREFKTYVGLHGTEEQIEENHP
FT                   EIQFKYKIVAKGKIPNDEYELEDYKYTVMSSEIIPLHYVLVALREFLYQTHITWDNRYG
FT                   YTFSDNTSPGMEVVTGEDVLHNNEEPQIKIHVDMKTADRTVTPVLEELIVDWIDQNDAP
FT                   QSYKLTTDEDFTLNNTRTQTTLADVEVGNGSVTLGRGSFSAVIDTEGSFLRGSQGISVR
FT                   VNREGSLSLNLPN"
     MTLLLNKHTT SMMSMLPQWM KMAKDPKSVG ALFLDAFGVE LSEIERYIEQ AWNDMYIGTT        60
     NLQKADYCYK IPLATRDVVD IETLDLHVRL VIDGVRRDCM PADTLRLFFE SDDNSYMIDT       120
     IEGYVYIKVM DYYMKDNIFK PFDAIEVGDT LHYEYMLHHI WNVFDEFGML LGISRLPGER       180
     NGDFKNRILD VFKNPGGATK QGLINGISRE LGIDKSEVKL GSLSDDKYVQ TKLMNTDGTP       240
     SETYIQYVNQ INSNLGFSWD HMNWGEAYWR SIEENNMGFH YLPHIWDGFS ASWKDNEVQS       300
     GIGSGDDLLV TAPKEESPVR EFKTYVGLHG TEEQIEENHP EIQFKYKIVA KGKIPNDEYE       360
     LEDYKYTVMS SEIIPLHYVL VALREFLYQT HITWDNRYGY TFSDNTSPGM EVVTGEDVLH       420
     NNEEPQIKIH VDMKTADRTV TPVLEELIVD WIDQNDAPQS YKLTTDEDFT LNNTRTQTTL       480
     ADVEVGNGSV TLGRGSFSAV IDTEGSFLRG SQGISVRVNR EGSLSLNLPN                  530
//

If you have problems or comments...

PBIL Back to PBIL home page