(data stored in ACNUC9435 zone)

EMBL: CP000904.PE10

CP000904.PE10        Location/Qualifiers
FT   CDS             27615..30392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6767 outer membrane
FT                   autotransporter barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46434"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV02"
FT                   /protein_id="ABY46434.1"
FT                   /translation="MELFSALASGSGPTMLYTVYADETSRSANSVTYSVTCWARLQNQT
FT                   YDYFGAVVYPKINIGGNTVSFANLGTFPKGAGAKFSTISVTVSGISATTSSVSYTFSAT
FT                   SQLGGTSSSTTGYVGGKSGTVSCSIYATTPWLSGQIWIKDGSTTVDSYYRENLGTGSFV
FT                   LNWSGANGANGTLTYEIQRQINGGAWTIVAADNNGTFSDAPGAGANSVRYSIQAKNKVG
FT                   TDVMRSDWIYSPTVYKNELRSPSLTSSAYVSYATRTFTLSLGAASDNLGSPISYTLTGI
FT                   ASKFTTINGPGGVSPGNITINANNGSSGIYMTIDNLKTAALNGTAHSDTNYYIGSIDLQ
FT                   VTATNGKGSSKTDTVSIPINLGMDAPVSGTPSVTIAATSYYLINTANYIFPEYKPVSLT
FT                   IAGAIKDMLGRNCSYDIVMVEGNSQSIIKNTGIVTAATTATVNHVESGLLTAKKNVSFY
FT                   VRAQTLGNEGKPSAQTPKVDLHYYKKPSVTSSDLSRITGKSTFKVVVTPSNSLGGATNT
FT                   STMPSGYTKGTSSIASGVETYTVTSSTTLADSYTALISVVVRDSVGYILSSNGSNDVTL
FT                   KVTIPTFTPALSIRERGIGINGFAGTTEKLYVGGNVKLTGNLIVGGIIDMGNTNIENVN
FT                   HITITDPGGGEGLEWKDPTNNWKIVVAPDNLGNATGDLQFARNGVRRATVRANGEVAAV
FT                   GGFATINPSNTNASVSLNFLNNIARIRTGGTGAGADNGFQIHGTGDVIRWSVDGAGTVS
FT                   NYGHLQMFNGKEIQFMNRSGMAFDGNGNMKPRDLLTHAAGAYWWVNDVNNNYPLKVWTG
FT                   ANGGYADVRSRPFTQVTAFTNGWADYGSFGPVAYTKDAAGFVVLQGLLRGNSGTSGSAF
FT                   QLPTGFRPSTSRIFNVVNGVNGHSRLDVNADGTVVMQGGAPEFCSLNGIRFLPA"
     MELFSALASG SGPTMLYTVY ADETSRSANS VTYSVTCWAR LQNQTYDYFG AVVYPKINIG        60
     GNTVSFANLG TFPKGAGAKF STISVTVSGI SATTSSVSYT FSATSQLGGT SSSTTGYVGG       120
     KSGTVSCSIY ATTPWLSGQI WIKDGSTTVD SYYRENLGTG SFVLNWSGAN GANGTLTYEI       180
     QRQINGGAWT IVAADNNGTF SDAPGAGANS VRYSIQAKNK VGTDVMRSDW IYSPTVYKNE       240
     LRSPSLTSSA YVSYATRTFT LSLGAASDNL GSPISYTLTG IASKFTTING PGGVSPGNIT       300
     INANNGSSGI YMTIDNLKTA ALNGTAHSDT NYYIGSIDLQ VTATNGKGSS KTDTVSIPIN       360
     LGMDAPVSGT PSVTIAATSY YLINTANYIF PEYKPVSLTI AGAIKDMLGR NCSYDIVMVE       420
     GNSQSIIKNT GIVTAATTAT VNHVESGLLT AKKNVSFYVR AQTLGNEGKP SAQTPKVDLH       480
     YYKKPSVTSS DLSRITGKST FKVVVTPSNS LGGATNTSTM PSGYTKGTSS IASGVETYTV       540
     TSSTTLADSY TALISVVVRD SVGYILSSNG SNDVTLKVTI PTFTPALSIR ERGIGINGFA       600
     GTTEKLYVGG NVKLTGNLIV GGIIDMGNTN IENVNHITIT DPGGGEGLEW KDPTNNWKIV       660
     VAPDNLGNAT GDLQFARNGV RRATVRANGE VAAVGGFATI NPSNTNASVS LNFLNNIARI       720
     RTGGTGAGAD NGFQIHGTGD VIRWSVDGAG TVSNYGHLQM FNGKEIQFMN RSGMAFDGNG       780
     NMKPRDLLTH AAGAYWWVND VNNNYPLKVW TGANGGYADV RSRPFTQVTA FTNGWADYGS       840
     FGPVAYTKDA AGFVVLQGLL RGNSGTSGSA FQLPTGFRPS TSRIFNVVNG VNGHSRLDVN       900
     ADGTVVMQGG APEFCSLNGI RFLPA                                             925
//

If you have problems or comments...

PBIL Back to PBIL home page