(data stored in ACNUC9435 zone)

EMBL: CP000904.PE100

CP000904.PE100       Location/Qualifiers
FT   CDS             complement(145655..146524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46524"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV92"
FT                   /protein_id="ABY46524.1"
FT                   /translation="MNQLSLTNKERTSNGKDVGSLRIAFTIENTTNSTFSFSFNKMRAT
FT                   TDQGELFEPSTFIKQNFINPTKKIDDTQDNKIVFNDYGTKDLESIQWVDFTFEINKKSP
FT                   EITIAKTQKYKIRFNIDQHYGGTTTKQEQPQTSSNTDDVTYKNEIKPKIDSMIKEFNNI
FT                   WNQEVKSVFNKEGETLATINQNTLQEQMELVSTKYRELSKENINFNSSDKINDPTLKEK
FT                   INKFREEFGAAANYRENAANAILQGIRDLAPMEDRMKEARKSIKISEQKFNNASTHLTE
FT                   FETKLNSK"
     MNQLSLTNKE RTSNGKDVGS LRIAFTIENT TNSTFSFSFN KMRATTDQGE LFEPSTFIKQ        60
     NFINPTKKID DTQDNKIVFN DYGTKDLESI QWVDFTFEIN KKSPEITIAK TQKYKIRFNI       120
     DQHYGGTTTK QEQPQTSSNT DDVTYKNEIK PKIDSMIKEF NNIWNQEVKS VFNKEGETLA       180
     TINQNTLQEQ MELVSTKYRE LSKENINFNS SDKINDPTLK EKINKFREEF GAAANYRENA       240
     ANAILQGIRD LAPMEDRMKE ARKSIKISEQ KFNNASTHLT EFETKLNSK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page