(data stored in ACNUC9435 zone)

EMBL: CP000904.PE101

CP000904.PE101       Location/Qualifiers
FT   CDS             complement(146799..147992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5543"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46525"
FT                   /db_xref="GOA:A9VV93"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV93"
FT                   /protein_id="ABY46525.1"
FT                   /translation="MKKILFAILSVIVVTVLVYYFFFSNSNVDLISEEDVQKKDFLKDK
FT                   QSVIYLSSTADQDMDGKGISYAVFINKNGEASGYKMNGLELGGIGVSENKKELLLESKD
FT                   KLKFVGENFKEFKMKYQHTGDYRAYLKNSDLFVNIYNSGSNPDTGGYDSNVVYGNKKGI
FT                   HKGNIPHYLISAGVDEETIPIMTHDIDKKEYTLKRLTFNDLKMKLEDVTEISVDKNMTY
FT                   SSYSSILSDSNSYYTVLVENDNTIKGKVYLLRVNKTTLKQELVLLSSEEDSTASIPFTK
FT                   NNSAYLHNNELYFINGLGNVITFNTQTNTVNTKFKIDYSVTDGVRYNEQTFFQGDQLYV
FT                   LRYDKNRKNNYYIEIYSLKDGKKIKETEISGMEEIIKSVRGGKSIHAYDFKVLDQSN"
     MKKILFAILS VIVVTVLVYY FFFSNSNVDL ISEEDVQKKD FLKDKQSVIY LSSTADQDMD        60
     GKGISYAVFI NKNGEASGYK MNGLELGGIG VSENKKELLL ESKDKLKFVG ENFKEFKMKY       120
     QHTGDYRAYL KNSDLFVNIY NSGSNPDTGG YDSNVVYGNK KGIHKGNIPH YLISAGVDEE       180
     TIPIMTHDID KKEYTLKRLT FNDLKMKLED VTEISVDKNM TYSSYSSILS DSNSYYTVLV       240
     ENDNTIKGKV YLLRVNKTTL KQELVLLSSE EDSTASIPFT KNNSAYLHNN ELYFINGLGN       300
     VITFNTQTNT VNTKFKIDYS VTDGVRYNEQ TFFQGDQLYV LRYDKNRKNN YYIEIYSLKD       360
     GKKIKETEIS GMEEIIKSVR GGKSIHAYDF KVLDQSN                                397
//

If you have problems or comments...

PBIL Back to PBIL home page