(data stored in ACNUC9435 zone)

EMBL: CP000904.PE102

CP000904.PE102       Location/Qualifiers
FT   CDS             complement(148055..148792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46526"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV94"
FT                   /protein_id="ABY46526.1"
FT                   /translation="MKKIHALTLTIGLITSAMAVPTATFAGSEELPHLSEIKKMQPDLS
FT                   TSELLSSIDEMAKNTGNTKDAIAEQIYKELKADEALGTKEANEKVKTLGAGGGTVSVGN
FT                   SNMGDFFYTGSYTAYLNHGHVGMYYSSNTIVESVPDNGVRTLSTTARKVDKGDAVVKSI
FT                   NTSWQNKNDAAWWAKDRVGKDGYSYNFATNRSTTHYGAKNCSKLIWSAYKLNGGLDLDK
FT                   DGGAGVYPRDVRDAKQTSTIRNI"
     MKKIHALTLT IGLITSAMAV PTATFAGSEE LPHLSEIKKM QPDLSTSELL SSIDEMAKNT        60
     GNTKDAIAEQ IYKELKADEA LGTKEANEKV KTLGAGGGTV SVGNSNMGDF FYTGSYTAYL       120
     NHGHVGMYYS SNTIVESVPD NGVRTLSTTA RKVDKGDAVV KSINTSWQNK NDAAWWAKDR       180
     VGKDGYSYNF ATNRSTTHYG AKNCSKLIWS AYKLNGGLDL DKDGGAGVYP RDVRDAKQTS       240
     TIRNI                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page