(data stored in ACNUC9435 zone)

EMBL: CP000904.PE103

CP000904.PE103       Location/Qualifiers
FT   CDS             complement(150137..150811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5546"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: btk:BT9727_1601 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46527"
FT                   /db_xref="GOA:A9VV95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV95"
FT                   /protein_id="ABY46527.1"
FT                   /translation="MIKLINLEKTYKLGKKTQYVIQGIDLIVEQGEMLAIMGRSGAGKS
FT                   TLLHILAGLEKPNGGSYYFQDKDITQLSYKELALFRKNNIGFILQNHALIEDKNIFDNV
FT                   ALPLLYGKASKKEIHSKVLKILQEMGLEDKVDQYPSELSGGEAQRIAIARALINDPDLI
FT                   LADEPTGSLDEETEQTILNLFTQLNRIGKTFILVTHDETVANVCNRVIRLKDGYIHDGS
FT                   VK"
     MIKLINLEKT YKLGKKTQYV IQGIDLIVEQ GEMLAIMGRS GAGKSTLLHI LAGLEKPNGG        60
     SYYFQDKDIT QLSYKELALF RKNNIGFILQ NHALIEDKNI FDNVALPLLY GKASKKEIHS       120
     KVLKILQEMG LEDKVDQYPS ELSGGEAQRI AIARALINDP DLILADEPTG SLDEETEQTI       180
     LNLFTQLNRI GKTFILVTHD ETVANVCNRV IRLKDGYIHD GSVK                        224
//

If you have problems or comments...

PBIL Back to PBIL home page