(data stored in ACNUC9435 zone)

EMBL: CP000904.PE104

CP000904.PE104       Location/Qualifiers
FT   CDS             complement(150816..152099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1600 conserved hypothetical
FT                   protein, possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46528"
FT                   /db_xref="GOA:A9VV96"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV96"
FT                   /protein_id="ABY46528.1"
FT                   /translation="MRTLLIELKESLLKKKMLSILILLQTCLLFALISALYLSFYKIDT
FT                   KTKSFYAQYEGKNIYKLSDQLFDEKEVEFFSNPNELLKVKNFYHTLLNSKDFLYLNTTL
FT                   QHIGVQNFKGQSIFLQGYEKGDPRPPYQKKEGLPSFDRVKSIQINDNVLSTFDVKVQKG
FT                   RVFNKEDFLFKKGTKIPIILGAEYQSTYNVGDTIYFDYLNQELEGMIVGILQKNTSFPV
FT                   NGDSEFYADRYVILPEFIMEEVPQNAEVLSFQQKHYLHAINGQIFTNKDMISVQKVVNA
FT                   ISQKVSFDDYIIIGANTIGISLMFTMMKQNIQLMSLFTAVIFIFCIISISLSLIMKWDT
FT                   NIKKYAIHLISGATVPQILLYAFAEILCVICLSLTLIFSFMQLVGEMPISYYFTLLGVS
FT                   LIIIVLGMLPFSFKLNQSNIVKILKKKE"
     MRTLLIELKE SLLKKKMLSI LILLQTCLLF ALISALYLSF YKIDTKTKSF YAQYEGKNIY        60
     KLSDQLFDEK EVEFFSNPNE LLKVKNFYHT LLNSKDFLYL NTTLQHIGVQ NFKGQSIFLQ       120
     GYEKGDPRPP YQKKEGLPSF DRVKSIQIND NVLSTFDVKV QKGRVFNKED FLFKKGTKIP       180
     IILGAEYQST YNVGDTIYFD YLNQELEGMI VGILQKNTSF PVNGDSEFYA DRYVILPEFI       240
     MEEVPQNAEV LSFQQKHYLH AINGQIFTNK DMISVQKVVN AISQKVSFDD YIIIGANTIG       300
     ISLMFTMMKQ NIQLMSLFTA VIFIFCIISI SLSLIMKWDT NIKKYAIHLI SGATVPQILL       360
     YAFAEILCVI CLSLTLIFSF MQLVGEMPIS YYFTLLGVSL IIIVLGMLPF SFKLNQSNIV       420
     KILKKKE                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page